BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000766-TA|BGIBMGA000766-PA|undefined (1690 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizo... 30 3.2 SPAC23D3.03c |||GTPase activating protein |Schizosaccharomyces p... 29 4.2 >SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1288 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Query: 1652 QEYAAALLAAVFDLGVRGRLNVETHLAKTIQTLNL--HRAC 1690 Q+Y L A+ D G L E L KTIQT+ L H AC Sbjct: 451 QQYGLEWLTALHDSNTNGILADEMGLGKTIQTIALLAHLAC 491 >SPAC23D3.03c |||GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 472 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/53 (30%), Positives = 24/53 (45%) Query: 622 LPPEDNPLQVDKLEIADLIFQLCQFNPPDNITLPQGYSPPPLAITSLYWRGWL 674 L P+D L + + + +FQ FN PD + P S A+ S+ WL Sbjct: 88 LSPQDQLLSLQLNNVQESVFQQSTFNLPDALLDPGPASKEKQAVLSIGRPSWL 140 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,498,508 Number of Sequences: 5004 Number of extensions: 238371 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 527 Number of HSP's gapped (non-prelim): 2 length of query: 1690 length of database: 2,362,478 effective HSP length: 83 effective length of query: 1607 effective length of database: 1,947,146 effective search space: 3129063622 effective search space used: 3129063622 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -