BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000766-TA|BGIBMGA000766-PA|undefined (1690 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17070.1 68418.m02000 expressed protein 33 2.2 At3g16730.1 68416.m02136 expressed protein ; expression supporte... 31 6.7 >At5g17070.1 68418.m02000 expressed protein Length = 277 Score = 32.7 bits (71), Expect = 2.2 Identities = 21/73 (28%), Positives = 34/73 (46%) Query: 1205 GLVRADPAVLPDLPPRADREHLVALLESATPSTLEAIGNKIIESQDTAVVVDVISLILER 1264 G+ R D AVLP++ E + + E TLEA+ + QD ++ +S L++ Sbjct: 33 GVQRQDHAVLPEVLEHPGAEQIADMSEEEVKRTLEAVASTGKFWQDWEILKGTLSYWLKK 92 Query: 1265 NQEGYYENKVKPE 1277 Y E K+ E Sbjct: 93 VLSEYSEAKMTDE 105 >At3g16730.1 68416.m02136 expressed protein ; expression supported by MPSS Length = 695 Score = 31.1 bits (67), Expect = 6.7 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query: 29 VVSRDAEKRNIHKPSTSAADRKRDASSYGSQPPSKRSRIGSPAETTGGTSLEVDPVD 85 V +R EKR IH P A S+ S PP KR+ S + T SL++ ++ Sbjct: 603 VHNRKNEKRGIHLPQKRAKSPITKGKSHESPPPKKRNTC-SVSSQTRKVSLKISKIN 658 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,495,490 Number of Sequences: 28952 Number of extensions: 1301212 Number of successful extensions: 3009 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3008 Number of HSP's gapped (non-prelim): 2 length of query: 1690 length of database: 12,070,560 effective HSP length: 91 effective length of query: 1599 effective length of database: 9,435,928 effective search space: 15088048872 effective search space used: 15088048872 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 66 (30.7 bits)
- SilkBase 1999-2023 -