SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000764-TA|BGIBMGA000764-PA|undefined
         (49 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0454 - 3234331-3236299,3237254-3238074                           25   7.5  

>06_01_0454 - 3234331-3236299,3237254-3238074
          Length = 929

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 8   ERFGALSFARVLPGNGALRNNRDIQESRAEHKASARLMYVA 48
           +  G L+  RVL       + RD  E++AEHK S + ++ +
Sbjct: 687 KELGELTKLRVLVVYWKAYHARDSDEAQAEHKKSCKKIFTS 727


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.321    0.130    0.360 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,228,857
Number of Sequences: 37544
Number of extensions: 26703
Number of successful extensions: 59
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 58
Number of HSP's gapped (non-prelim): 1
length of query: 49
length of database: 14,793,348
effective HSP length: 30
effective length of query: 19
effective length of database: 13,667,028
effective search space: 259673532
effective search space used: 259673532
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -