Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000764-TA|BGIBMGA000764-PA|undefined
         (49 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N domain-...    25   8.2  

>At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N
           domain-containing protein low similarity to NUB1
           (NEDD8-interacting protein) [Homo sapiens] GI:13383476;
           contains Pfam profile PF00627: UBA/TS-N domain
          Length = 562

 Score = 24.6 bits (51), Expect = 8.2
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 5   QTAERFGALSFARVLPGNGALRNNRDIQES 34
           Q  ER  ++ +AR L      RN  DIQ++
Sbjct: 359 QMLERLVSIGYARELAAESLRRNENDIQKA 388


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.321    0.130    0.360 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 947,255
Number of Sequences: 28952
Number of extensions: 20090
Number of successful extensions: 31
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 30
Number of HSP's gapped (non-prelim): 1
length of query: 49
length of database: 12,070,560
effective HSP length: 30
effective length of query: 19
effective length of database: 11,202,000
effective search space: 212838000
effective search space used: 212838000
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 51 (24.6 bits)