BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000764-TA|BGIBMGA000764-PA|undefined (49 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39822| Best HMM Match : TPR_div1 (HMM E-Value=8.9) 26 3.8 >SB_39822| Best HMM Match : TPR_div1 (HMM E-Value=8.9) Length = 186 Score = 26.2 bits (55), Expect = 3.8 Identities = 15/41 (36%), Positives = 18/41 (43%) Query: 4 DQTAERFGALSFARVLPGNGALRNNRDIQESRAEHKASARL 44 DQ E S+ LP N ALR +D S + K RL Sbjct: 81 DQLRELLETPSYIETLPENQALRKAKDFYRSCMDTKTIERL 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.130 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,370,319 Number of Sequences: 59808 Number of extensions: 28949 Number of successful extensions: 48 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 47 Number of HSP's gapped (non-prelim): 1 length of query: 49 length of database: 16,821,457 effective HSP length: 29 effective length of query: 20 effective length of database: 15,087,025 effective search space: 301740500 effective search space used: 301740500 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -