GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000761-TA|BGIBMGA000761-PA|undefined
         (281 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    25   0.84 

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 24.6 bits (51), Expect = 0.84
 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 2/67 (2%)

Query: 204 YCTTESLQLSRLTAIEARRFPINCARYIRYNVFTGHPRGDAQYLYYAPVFIHA--QFARQ 261
           YC + +  +  L  + +  F ++   Y  + +FT H      Y YYA + +     F   
Sbjct: 60  YCVSITFNVHLLFLLCSGYFTVHLLFYCPFIIFTVHFLLCTYYFYYAFIILLCVYYFYYA 119

Query: 262 FILYWQH 268
           FI++  H
Sbjct: 120 FIIFTVH 126


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.138    0.440 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,114
Number of Sequences: 317
Number of extensions: 2580
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 281
length of database: 114,650
effective HSP length: 56
effective length of query: 225
effective length of database: 96,898
effective search space: 21802050
effective search space used: 21802050
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)