BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000761-TA|BGIBMGA000761-PA|undefined (281 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.84 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.84 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Query: 204 YCTTESLQLSRLTAIEARRFPINCARYIRYNVFTGHPRGDAQYLYYAPVFIHA--QFARQ 261 YC + + + L + + F ++ Y + +FT H Y YYA + + F Sbjct: 60 YCVSITFNVHLLFLLCSGYFTVHLLFYCPFIIFTVHFLLCTYYFYYAFIILLCVYYFYYA 119 Query: 262 FILYWQH 268 FI++ H Sbjct: 120 FIIFTVH 126 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.138 0.440 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,114 Number of Sequences: 317 Number of extensions: 2580 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 1 length of query: 281 length of database: 114,650 effective HSP length: 56 effective length of query: 225 effective length of database: 96,898 effective search space: 21802050 effective search space used: 21802050 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -