BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000759-TA|BGIBMGA000759-PA|undefined (76 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 1.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 1.9 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 19 4.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 19 5.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 19 5.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 19 5.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 19 5.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 19 5.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 19 5.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 19 5.9 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 19 5.9 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 19 5.9 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 19 7.8 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 1.5 Identities = 10/42 (23%), Positives = 18/42 (42%) Query: 24 YKFYLQNLWLWRYWAAAIVISSPLFYKIHKMSNSPENVSKWA 65 + FY QN W+ + + F K+ + + P S W+ Sbjct: 174 FPFYRQNQQRWQNSIRHSLSFNDCFVKVPRTPDKPGKGSFWS 215 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.6 bits (41), Expect = 1.9 Identities = 12/46 (26%), Positives = 20/46 (43%) Query: 31 LWLWRYWAAAIVISSPLFYKIHKMSNSPENVSKWAEIRRKEAAEHH 76 L L + I+ ++ +FY H ++ VSK E+ K H Sbjct: 630 LHLLYIFLVGIMYAADVFYICHVCCSTIHEVSKAGELIHKIETNDH 675 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 19.4 bits (38), Expect = 4.5 Identities = 5/15 (33%), Positives = 8/15 (53%) Query: 24 YKFYLQNLWLWRYWA 38 Y+ N W +YW+ Sbjct: 67 YQILAYNFWKKKYWS 81 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 19.0 bits (37), Expect = 5.9 Identities = 4/9 (44%), Positives = 6/9 (66%) Query: 29 QNLWLWRYW 37 Q+ W+W W Sbjct: 216 QHAWIWLVW 224 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 19.0 bits (37), Expect = 5.9 Identities = 4/9 (44%), Positives = 6/9 (66%) Query: 29 QNLWLWRYW 37 Q+ W+W W Sbjct: 462 QHAWIWLLW 470 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 19.0 bits (37), Expect = 5.9 Identities = 4/9 (44%), Positives = 6/9 (66%) Query: 29 QNLWLWRYW 37 Q+ W+W W Sbjct: 462 QHAWIWLLW 470 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 19.0 bits (37), Expect = 5.9 Identities = 4/9 (44%), Positives = 6/9 (66%) Query: 29 QNLWLWRYW 37 Q+ W+W W Sbjct: 449 QHAWIWLVW 457 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 19.0 bits (37), Expect = 5.9 Identities = 4/9 (44%), Positives = 6/9 (66%) Query: 29 QNLWLWRYW 37 Q+ W+W W Sbjct: 449 QHAWIWLVW 457 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 19.0 bits (37), Expect = 5.9 Identities = 4/9 (44%), Positives = 6/9 (66%) Query: 29 QNLWLWRYW 37 Q+ W+W W Sbjct: 462 QHAWIWLLW 470 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 19.0 bits (37), Expect = 5.9 Identities = 4/9 (44%), Positives = 6/9 (66%) Query: 29 QNLWLWRYW 37 Q+ W+W W Sbjct: 462 QHAWIWLLW 470 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 19.0 bits (37), Expect = 5.9 Identities = 7/27 (25%), Positives = 13/27 (48%) Query: 7 RPMKFPYTFSAKIAQFPYKFYLQNLWL 33 + +KF + P KFY+Q ++ Sbjct: 79 KKLKFLLKLGQLLGLAPVKFYVQKFYV 105 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 19.0 bits (37), Expect = 5.9 Identities = 7/27 (25%), Positives = 13/27 (48%) Query: 7 RPMKFPYTFSAKIAQFPYKFYLQNLWL 33 + +KF + P KFY+Q ++ Sbjct: 5 KKLKFLLKLGQLLGLAPVKFYVQKFYV 31 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 18.6 bits (36), Expect = 7.8 Identities = 5/16 (31%), Positives = 8/16 (50%) Query: 26 FYLQNLWLWRYWAAAI 41 F N+WL+ W + Sbjct: 151 FIFDNVWLFILWVGIL 166 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.132 0.445 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,087 Number of Sequences: 317 Number of extensions: 763 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 76 length of database: 114,650 effective HSP length: 45 effective length of query: 31 effective length of database: 100,385 effective search space: 3111935 effective search space used: 3111935 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.7 bits) S2: 36 (18.6 bits)
- SilkBase 1999-2023 -