GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000756-TA|BGIBMGA000756-PA|IPR003029|RNA binding S1,
IPR008994|Nucleic acid-binding, OB-fold
         (250 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   8.5  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 187  EDH--GYVMDLGIPNTTAFLPKKDANPEID 214
            E+H  G +   G  +T   +PK ++NP I+
Sbjct: 3153 EEHLDGMISCFGHSSTVTIIPKFESNPRIE 3182


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.315    0.133    0.382 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 239,232
Number of Sequences: 2123
Number of extensions: 8910
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 1
length of query: 250
length of database: 516,269
effective HSP length: 62
effective length of query: 188
effective length of database: 384,643
effective search space: 72312884
effective search space used: 72312884
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 47 (23.0 bits)