BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000755-TA|BGIBMGA000755-PA|undefined (230 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.6 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 4.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 65 STPWSSETWDSAVFNSANSEKTLTPKSSTSYGATTP 100 ST WSS T S + + + +T T + +T+ T P Sbjct: 1040 STWWSSTT-TSPWWTTTTTRRTTTTRPTTTSTTTRP 1074 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 4.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 65 STPWSSETWDSAVFNSANSEKTLTPKSSTSYGA 97 S+P SS ++D N + L+P S Y A Sbjct: 136 SSPMSSGSYDPYSPNGKIGREDLSPSSLNGYSA 168 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.124 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,663 Number of Sequences: 317 Number of extensions: 1353 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 230 length of database: 114,650 effective HSP length: 55 effective length of query: 175 effective length of database: 97,215 effective search space: 17012625 effective search space used: 17012625 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -