BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000754-TA|BGIBMGA000754-PA|IPR005289|GTP-binding, IPR002917|GTP-binding protein, HSR1-related (333 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.4 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 7.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 2.4 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 184 RSLMMKMRINNDPCIFMLDTPGI-LEPSVTNIEMGLKLALC 223 + L MK+ NND C+ + T LE S N L+ LC Sbjct: 296 QDLSMKLSKNNDQCLDLSKTKETNLEKSNLNHNEQLRKYLC 336 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 2.4 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 184 RSLMMKMRINNDPCIFMLDTPGI-LEPSVTNIEMGLKLALC 223 + L MK+ NND C+ + T LE S N L+ LC Sbjct: 188 QDLSMKLSKNNDQCLDLSKTKETNLEKSNLNHNEQLRKYLC 228 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/38 (26%), Positives = 17/38 (44%) Query: 101 QNVDNVVFTNSKDQFCRGLKTIKPLMVDLIKNSNRYNR 138 +N V C+ + K L+V + K+ +RY R Sbjct: 43 KNNGECVINKKNRTACKACRLRKCLLVGMSKSGSRYGR 80 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.140 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,855 Number of Sequences: 317 Number of extensions: 2999 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 333 length of database: 114,650 effective HSP length: 57 effective length of query: 276 effective length of database: 96,581 effective search space: 26656356 effective search space used: 26656356 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -