BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000753-TA|BGIBMGA000753-PA|IPR008616|Fibronectin-binding A, N-terminal, IPR008532|Protein of unknown function DUF814 (992 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 29 0.21 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 29 0.21 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 24 5.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 5.9 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 28.7 bits (61), Expect = 0.21 Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 317 EREALKKLQNVRRDHERRVTELERAQTRDKRA 348 E E L+K+Q RD R++ LE+ Q D R+ Sbjct: 1098 ENEQLRKIQESLRDLNRKIESLEKMQYPDLRS 1129 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 28.7 bits (61), Expect = 0.21 Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 317 EREALKKLQNVRRDHERRVTELERAQTRDKRA 348 E E L+K+Q RD R++ LE+ Q D R+ Sbjct: 1098 ENEQLRKIQESLRDLNRKIESLEKMQYPDLRS 1129 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 319 EALKKLQNVRRDHERRVTELER 340 + L +L +V RD+ R +TEL+R Sbjct: 68 QPLNELFDVTRDNYRHITELKR 89 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 792 KIKEKYKDQDEDERLY 807 KIK + +D+DEDER + Sbjct: 883 KIKREAEDRDEDERSF 898 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.132 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,524 Number of Sequences: 317 Number of extensions: 8718 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 4 length of query: 992 length of database: 114,650 effective HSP length: 64 effective length of query: 928 effective length of database: 94,362 effective search space: 87567936 effective search space used: 87567936 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -