BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000752-TA|BGIBMGA000752-PA|IPR008949|Terpenoid synthase (377 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 3.6 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 22 6.3 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 3.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 306 LHENPKLYHGLENAKS 321 LH+NP L GL+ A++ Sbjct: 29 LHDNPSLREGLKGART 44 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 22.2 bits (45), Expect = 6.3 Identities = 11/42 (26%), Positives = 22/42 (52%) Query: 143 SMFANKIAILIGDYLLVTANGMLARLKNQDLSYLISTALRDL 184 S F N + +++V +LA+ + QD++ L T ++L Sbjct: 44 SDFENYVTFFCSLFIVVILKLILAKYRQQDVTLLQITKAKNL 85 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,073 Number of Sequences: 317 Number of extensions: 3648 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 377 length of database: 114,650 effective HSP length: 58 effective length of query: 319 effective length of database: 96,264 effective search space: 30708216 effective search space used: 30708216 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -