BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000751-TA|BGIBMGA000751-PA|undefined (64 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 82 4e-19 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 82 4e-19 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 0.33 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 20 2.3 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 82.2 bits (194), Expect = 4e-19 Identities = 39/50 (78%), Positives = 39/50 (78%) Query: 4 GDASNASIGSXXXXXXXXXXXNGKKNQKKRGIFPKVATNILRAWLFQHLT 53 GDASNASIGS NGKKNQKKRGIFPKVATNILRAWLFQHLT Sbjct: 153 GDASNASIGSGEGTGEEDDDTNGKKNQKKRGIFPKVATNILRAWLFQHLT 202 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 82.2 bits (194), Expect = 4e-19 Identities = 39/50 (78%), Positives = 39/50 (78%) Query: 4 GDASNASIGSXXXXXXXXXXXNGKKNQKKRGIFPKVATNILRAWLFQHLT 53 GDASNASIGS NGKKNQKKRGIFPKVATNILRAWLFQHLT Sbjct: 309 GDASNASIGSGEGTGEEDDDTNGKKNQKKRGIFPKVATNILRAWLFQHLT 358 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 0.33 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 30 QKKRGIFPKVATNILRAWLFQHLT 53 ++KR F K A+ IL + + HL+ Sbjct: 231 RRKRRNFSKQASEILNEYFYSHLS 254 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 19.8 bits (39), Expect = 2.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Query: 34 GIFPKVATNILRAWLFQHL 52 G PK TNI A L Q L Sbjct: 312 GHIPKTQTNIAIATLIQSL 330 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.129 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,836 Number of Sequences: 317 Number of extensions: 211 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 64 length of database: 114,650 effective HSP length: 43 effective length of query: 21 effective length of database: 101,019 effective search space: 2121399 effective search space used: 2121399 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.4 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -