Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000751-TA|BGIBMGA000751-PA|undefined
         (64 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi...    21   3.2  
EF065522-1|ABK59322.1|  255|Anopheles gambiae beta carbonic anhy...    20   9.7  

>AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing
           protein I protein.
          Length = 1340

 Score = 21.4 bits (43), Expect = 3.2
 Identities = 8/31 (25%), Positives = 17/31 (54%)

Query: 25  NGKKNQKKRGIFPKVATNILRAWLFQHLTVG 55
           N  ++ K  G      TN   +WL++++++G
Sbjct: 611 NALQSGKPIGKLVSYRTNFQESWLWKNVSIG 641


>EF065522-1|ABK59322.1|  255|Anopheles gambiae beta carbonic
           anhydrase protein.
          Length = 255

 Score = 19.8 bits (39), Expect = 9.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)

Query: 44  LRAWLFQHLTVGL 56
           LRAWL +H    L
Sbjct: 130 LRAWLCEHANTSL 142


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.315    0.129    0.368 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,626
Number of Sequences: 2123
Number of extensions: 963
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 64
length of database: 516,269
effective HSP length: 43
effective length of query: 21
effective length of database: 424,980
effective search space:  8924580
effective search space used:  8924580
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.7 bits)
S2: 39 (19.8 bits)