BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000750-TA|BGIBMGA000750-PA|undefined (97 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 48 2e-08 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 48 2e-08 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 20 4.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 19 7.0 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 48.0 bits (109), Expect = 2e-08 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 9/38 (23%) Query: 3 VGKWCPSRREWSSPP------DVARR--VYSSVFLGSP 32 +GKWCP RREWSSPP D ARR +YSSVFLGSP Sbjct: 116 MGKWCP-RREWSSPPDARAASDAARRGVLYSSVFLGSP 152 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 48.0 bits (109), Expect = 2e-08 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 9/38 (23%) Query: 3 VGKWCPSRREWSSPP------DVARR--VYSSVFLGSP 32 +GKWCP RREWSSPP D ARR +YSSVFLGSP Sbjct: 272 MGKWCP-RREWSSPPDARAASDAARRGVLYSSVFLGSP 308 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 20.2 bits (40), Expect = 4.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 40 LTAKSLSVMSRRNIGSHVSVA 60 L S V++ +GSHV+V+ Sbjct: 536 LHGHSFRVVAMERVGSHVNVS 556 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.4 bits (38), Expect = 7.0 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 72 YLNVHGVGCYGYVERWN-VSGTV 93 YL+ V CY Y +W+ ++G V Sbjct: 2006 YLDWIAVMCYDYHGQWDKITGHV 2028 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.132 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,302 Number of Sequences: 317 Number of extensions: 726 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 97 length of database: 114,650 effective HSP length: 48 effective length of query: 49 effective length of database: 99,434 effective search space: 4872266 effective search space used: 4872266 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -