Silkworm BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000746-TA|BGIBMGA000746-PA|undefined
         (437 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF099919-3|AAC68801.2|  862|Caenorhabditis elegans Hypothetical ...    32   0.92 

>AF099919-3|AAC68801.2|  862|Caenorhabditis elegans Hypothetical
           protein F40G9.9 protein.
          Length = 862

 Score = 31.9 bits (69), Expect = 0.92
 Identities = 21/62 (33%), Positives = 26/62 (41%), Gaps = 3/62 (4%)

Query: 192 VPGFSNEIEPGSSSEVVPEFTSEIIPGNTIQFALEVLPEAVPGISSEKLPGIENENVPYA 251
           VP F     PG     VP F    +PG  IQ +  V    VPG    ++PGI+    P  
Sbjct: 410 VPEFQGFRVPGFQGFRVPGFQGSRVPG--IQ-SFRVQVSRVPGFQGARVPGIQGSRFPGI 466

Query: 252 TG 253
            G
Sbjct: 467 QG 468


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.313    0.133    0.381 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,069,683
Number of Sequences: 27539
Number of extensions: 258931
Number of successful extensions: 302
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 300
Number of HSP's gapped (non-prelim): 6
length of query: 437
length of database: 12,573,161
effective HSP length: 84
effective length of query: 353
effective length of database: 10,259,885
effective search space: 3621739405
effective search space used: 3621739405
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 61 (28.7 bits)