BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000746-TA|BGIBMGA000746-PA|undefined (437 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42940.1 68418.m05235 zinc finger (C3HC4-type RING finger) fa... 31 1.1 At2g25840.3 68415.m03102 tRNA synthetase class I (W and Y) famil... 30 2.6 At2g25840.2 68415.m03101 tRNA synthetase class I (W and Y) famil... 30 2.6 At2g25840.1 68415.m03100 tRNA synthetase class I (W and Y) famil... 30 2.6 >At5g42940.1 68418.m05235 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 691 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/64 (29%), Positives = 29/64 (45%) Query: 192 VPGFSNEIEPGSSSEVVPEFTSEIIPGNTIQFALEVLPEAVPGISSEKLPGIENENVPYA 251 V G SN P + + E S IPGNT++ + PE S+ + N N+ A Sbjct: 349 VGGTSNSTAPVERNLHLDETRSRSIPGNTLEIPMFAAPEVGNFARSQSSRNVTNGNLNSA 408 Query: 252 TGVA 255 + V+ Sbjct: 409 SSVS 412 >At2g25840.3 68415.m03102 tRNA synthetase class I (W and Y) family protein contains Pfam profile: PF00579 tRNA synthetases class I (W and Y) Length = 396 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 278 EQKTLIVDEIKPFQIDGFRPLHFDLLHRPD 307 + K LIVD+IK + D F L FD RP+ Sbjct: 273 DSKDLIVDKIKRCKTDSFAGLEFDNAERPE 302 >At2g25840.2 68415.m03101 tRNA synthetase class I (W and Y) family protein contains Pfam profile: PF00579 tRNA synthetases class I (W and Y) Length = 412 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 278 EQKTLIVDEIKPFQIDGFRPLHFDLLHRPD 307 + K LIVD+IK + D F L FD RP+ Sbjct: 289 DSKDLIVDKIKRCKTDSFAGLEFDNAERPE 318 >At2g25840.1 68415.m03100 tRNA synthetase class I (W and Y) family protein contains Pfam profile: PF00579 tRNA synthetases class I (W and Y) Length = 408 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 278 EQKTLIVDEIKPFQIDGFRPLHFDLLHRPD 307 + K LIVD+IK + D F L FD RP+ Sbjct: 285 DSKDLIVDKIKRCKTDSFAGLEFDNAERPE 314 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.313 0.133 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,676,149 Number of Sequences: 28952 Number of extensions: 241447 Number of successful extensions: 339 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 335 Number of HSP's gapped (non-prelim): 4 length of query: 437 length of database: 12,070,560 effective HSP length: 83 effective length of query: 354 effective length of database: 9,667,544 effective search space: 3422310576 effective search space used: 3422310576 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -