BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000743-TA|BGIBMGA000743-PA|IPR001107|Band 7 protein, IPR004851|Flotillin (423 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.91 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 3.7 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.4 bits (53), Expect = 0.91 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 95 TEQEIQHIALVTLEGHQRAIMGSMT 119 T QE+ + VTL GHQ+ IM S+T Sbjct: 958 TVQELTALG-VTLVGHQKKIMNSVT 981 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.4 bits (48), Expect = 3.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 206 FLNDTEIAKSQRDFELKKAAYDVEVHTKKAEAEM 239 F D +A +Q+ ELK A ++ +KK E M Sbjct: 348 FSRDLMLAGTQQSVELKLALDQEQLKSKKLEESM 381 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.129 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,320 Number of Sequences: 429 Number of extensions: 2357 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 423 length of database: 140,377 effective HSP length: 60 effective length of query: 363 effective length of database: 114,637 effective search space: 41613231 effective search space used: 41613231 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -