BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000742-TA|BGIBMGA000742-PA|IPR003877|SPla/RYanodine receptor SPRY, IPR001870|B302, (SPRY)-like (546 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 25 3.9 AY070255-1|AAL59654.1| 230|Anopheles gambiae glutathione S-tran... 25 6.9 AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodi... 24 9.1 AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodi... 24 9.1 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 24 9.1 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 25.4 bits (53), Expect = 3.9 Identities = 8/29 (27%), Positives = 15/29 (51%) Query: 109 IVFDDCPLPSRDSVIKLTKLFRLSRQRAL 137 + DDCP P S+++L ++ + L Sbjct: 108 LTIDDCPFPHHQSILQLVSFLGTTQVKVL 136 >AY070255-1|AAL59654.1| 230|Anopheles gambiae glutathione S-transferase E5 protein. Length = 230 Score = 24.6 bits (51), Expect = 6.9 Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 262 TVDMTPINVILNSHDVSEYLKIS 284 ++D+ PIN++ H E+L+++ Sbjct: 31 SLDIVPINLLAGDHRTDEFLRLN 53 >AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 9.1 Identities = 10/34 (29%), Positives = 21/34 (61%) Query: 173 TLDFLLAFLDTNFEPCIVLFALIALEKFAHTTEN 206 ++ +LLA+L +F I ++ + LE ++ TE+ Sbjct: 15 SITYLLAYLVISFLIVINMYIAVILENYSQATED 48 >AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 24.2 bits (50), Expect = 9.1 Identities = 10/34 (29%), Positives = 21/34 (61%) Query: 173 TLDFLLAFLDTNFEPCIVLFALIALEKFAHTTEN 206 ++ +LLA+L +F I ++ + LE ++ TE+ Sbjct: 15 SITYLLAYLVISFLIVINMYIAVILENYSQATED 48 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.2 bits (50), Expect = 9.1 Identities = 21/85 (24%), Positives = 32/85 (37%), Gaps = 4/85 (4%) Query: 434 HLPFSFPPTDRPFMAFNDYARLTDEEKKVLPRRYYLEKVRNA-SIPENACTLC---YDAV 489 H P +P TD +D+ R+T EE + + + K IP A + Y V Sbjct: 414 HPPVYWPETDDVDSGASDFDRVTPEELQEIAAHMAIRKAPGLDGIPNAAVKVAIEKYPGV 473 Query: 490 ADCTLEPCFHNDTSSGNGSPRRLTL 514 + C + T +RL L Sbjct: 474 FCRVYQDCLNTGTFPQQWKRQRLVL 498 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.322 0.137 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 577,686 Number of Sequences: 2123 Number of extensions: 23220 Number of successful extensions: 80 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 76 Number of HSP's gapped (non-prelim): 5 length of query: 546 length of database: 516,269 effective HSP length: 67 effective length of query: 479 effective length of database: 374,028 effective search space: 179159412 effective search space used: 179159412 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -