BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000741-TA|BGIBMGA000741-PA|undefined (157 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0124 - 5749183-5749773,5750628-5751160,5751191-5753035,575... 27 7.0 03_01_0455 + 3487354-3488090,3489172-3489255,3489942-3490554,349... 27 9.2 >03_02_0124 - 5749183-5749773,5750628-5751160,5751191-5753035, 5753632-5753820,5753911-5754013,5754087-5754269, 5754392-5754484,5755031-5755219,5756133-5756327 Length = 1306 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 39 RAHGETGGVRVTRQADDIPVFDRNKVS 65 R+H E G+R RQA D +DR + S Sbjct: 1156 RSHSERSGIRSDRQAADENQYDRQRRS 1182 >03_01_0455 + 3487354-3488090,3489172-3489255,3489942-3490554, 3491356-3491583,3492270-3492437,3492828-3494587, 3494667-3494670 Length = 1197 Score = 26.6 bits (56), Expect = 9.2 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Query: 44 TGGVRVTRQADDIPVFDRNKVSLDFPGSL--FGPSVSLLIRTTKIIGDVVQNSAVRYQSF 101 TGG ++ + F+ + + F GS+ G +SL+ + +I DV +N +V Q+ Sbjct: 1055 TGGSTQDQREQAVHRFNNSPDARVFFGSIKACGEGISLVGASRIVILDVHENPSVMRQAI 1114 Query: 102 LRLFRP 107 R +RP Sbjct: 1115 GRAYRP 1120 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.326 0.140 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,868,755 Number of Sequences: 37544 Number of extensions: 83214 Number of successful extensions: 161 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 160 Number of HSP's gapped (non-prelim): 2 length of query: 157 length of database: 14,793,348 effective HSP length: 76 effective length of query: 81 effective length of database: 11,940,004 effective search space: 967140324 effective search space used: 967140324 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -