Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000741-TA|BGIBMGA000741-PA|undefined
         (157 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g31010.1 68414.m03797 expressed protein contains Pfam PF05329...    27   7.7  

>At1g31010.1 68414.m03797 expressed protein contains Pfam PF05329:
           Protein of unknown function (DUF731)
          Length = 360

 Score = 26.6 bits (56), Expect = 7.7
 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 83  TTKIIGDVVQNSAVRYQSFLRLFRPLFRGPF 113
           T +I+GDV+Q+ A   Q+ ++LF+  F G F
Sbjct: 146 TGQILGDVIQSGANSDQAHVQLFKS-FHGSF 175


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.326    0.140    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,295,008
Number of Sequences: 28952
Number of extensions: 66689
Number of successful extensions: 132
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 132
Number of HSP's gapped (non-prelim): 1
length of query: 157
length of database: 12,070,560
effective HSP length: 75
effective length of query: 82
effective length of database: 9,899,160
effective search space: 811731120
effective search space used: 811731120
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 56 (26.6 bits)