BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000741-TA|BGIBMGA000741-PA|undefined
(157 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 2.1
>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
candidate 46 protein.
Length = 1451
Score = 22.2 bits (45), Expect = 2.1
Identities = 11/34 (32%), Positives = 19/34 (55%)
Query: 72 LFGPSVSLLIRTTKIIGDVVQNSAVRYQSFLRLF 105
+FG S L+ +T II +VQ+ + + L +F
Sbjct: 603 MFGVSFLLITQTIFIICVIVQSEQIAWLHLLYIF 636
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.326 0.140 0.416
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,391
Number of Sequences: 317
Number of extensions: 586
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 157
length of database: 114,650
effective HSP length: 52
effective length of query: 105
effective length of database: 98,166
effective search space: 10307430
effective search space used: 10307430
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 40 (20.2 bits)
- SilkBase 1999-2023 -