BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000741-TA|BGIBMGA000741-PA|undefined (157 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 25 1.5 AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B pro... 22 7.8 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 24.6 bits (51), Expect = 1.5 Identities = 14/52 (26%), Positives = 23/52 (44%) Query: 47 VRVTRQADDIPVFDRNKVSLDFPGSLFGPSVSLLIRTTKIIGDVVQNSAVRY 98 V V Q D+ P F + +D P ++ +V L ++ T + VRY Sbjct: 502 VVVLDQNDNFPEFSQPVYDIDVPENVIAGTVLLQLQATDSDSGLFGTEGVRY 553 >AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B protein. Length = 103 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 48 RVTRQADDIPVFDRNKVSLDFPGSLFGPSVSLLI 81 R+ DDI +F G L GP+ + +I Sbjct: 56 RIYAHVDDIDLFPGGMSERPLQGGLVGPTFACII 89 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.140 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,183 Number of Sequences: 2123 Number of extensions: 2768 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 157 length of database: 516,269 effective HSP length: 59 effective length of query: 98 effective length of database: 391,012 effective search space: 38319176 effective search space used: 38319176 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -