BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000741-TA|BGIBMGA000741-PA|undefined
(157 letters)
Database: celegans
27,539 sequences; 12,573,161 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U43375-10|AAA83627.1| 520|Caenorhabditis elegans Hypothetical p... 30 0.66
>U43375-10|AAA83627.1| 520|Caenorhabditis elegans Hypothetical
protein K09C4.1a protein.
Length = 520
Score = 30.3 bits (65), Expect = 0.66
Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
Query: 56 IPVFDRNKVSLDFPGSLFGPSVSLLIRTTKIIGDVVQNSAV--RYQSFLRLFRPLFRGPF 113
+PV N + + F LF PS + + G + NS + Y +F P+F PF
Sbjct: 379 VPVTGANSIRVLFVTELFPPSARTAVGQAMLFGSMAVNSPIVALYPIVNSIFPPIFFVPF 438
Query: 114 EI 115
I
Sbjct: 439 VI 440
Database: celegans
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 12,573,161
Number of sequences in database: 27,539
Lambda K H
0.326 0.140 0.416
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,341,469
Number of Sequences: 27539
Number of extensions: 66529
Number of successful extensions: 134
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 134
Number of HSP's gapped (non-prelim): 1
length of query: 157
length of database: 12,573,161
effective HSP length: 76
effective length of query: 81
effective length of database: 10,480,197
effective search space: 848895957
effective search space used: 848895957
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 56 (26.6 bits)
- SilkBase 1999-2023 -