BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000739-TA|BGIBMGA000739-PA|undefined (170 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 27 0.11 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 24 0.77 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 1.3 AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 23 1.8 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 1.8 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.1 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 4.1 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 5.4 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 20 9.5 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 26.6 bits (56), Expect = 0.11 Identities = 8/33 (24%), Positives = 22/33 (66%) Query: 112 IVSPDGGLNILPFSDVYSDVLAKHKQKMIKKRL 144 +++PD GL++L + ++ ++L H ++ ++ L Sbjct: 380 LLNPDLGLSLLQVAQIFKNLLENHYEEFVRYEL 412 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.8 bits (49), Expect = 0.77 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Query: 113 VSPDGGLNILPFSD-------VYSDVLAKHKQKMIKKRLERVLEE 150 V P G LNI+P D ++ D K K++ ++ +VLEE Sbjct: 178 VKPRGVLNIIPKQDNFRAIVSIFPDSARKPFFKLLTSKIYKVLEE 222 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/36 (27%), Positives = 16/36 (44%) Query: 40 KTTNNTNFIPLPVPVPISQSIQIPQTVPVPYGLPLP 75 K+ + T P V + P++V P G+P P Sbjct: 192 KSASRTTTSPTKVKASKASPAAAPRSVATPTGIPTP 227 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 126 DVYSDVLAKHKQKMIKKRLERVL 148 +++SDVL + + I KRL RV+ Sbjct: 17 NIFSDVLEESQTLEILKRLNRVV 39 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 126 DVYSDVLAKHKQKMIKKRLERVL 148 +++SDVL + + I KRL RV+ Sbjct: 77 NIFSDVLEESQTLEILKRLNRVV 99 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 126 DVYSDVLAKHKQKMIKKRLERVL 148 +++SDVL + + I KRL RV+ Sbjct: 77 NIFSDVLEESQTLEILKRLNRVV 99 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Query: 21 PLYWYPKNLPDY 32 PLY+YP ++ DY Sbjct: 2528 PLYYYPGDVYDY 2539 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 18 PCNPLYWYPKNLPDYCY 34 P + Y YP LP+Y Y Sbjct: 273 PLSMYYQYPFGLPEYEY 289 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 5.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 39 IKTTNNTNFIPLPVPVPISQSIQIPQTV 66 IK + T F+ P PVP + + T+ Sbjct: 298 IKLHDKTPFLKRPYPVPFALRPAVDATI 325 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 20.2 bits (40), Expect = 9.5 Identities = 6/16 (37%), Positives = 10/16 (62%) Query: 54 VPISQSIQIPQTVPVP 69 VP ++ +P T+P P Sbjct: 201 VPPTEDCDVPSTIPPP 216 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.143 0.462 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,567 Number of Sequences: 317 Number of extensions: 2752 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 170 length of database: 114,650 effective HSP length: 53 effective length of query: 117 effective length of database: 97,849 effective search space: 11448333 effective search space used: 11448333 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -