BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000738-TA|BGIBMGA000738-PA|undefined (195 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 1.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 3.4 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.8 bits (49), Expect = 1.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 165 HISVGAKFQRYHTKSLISRKYSNLG 189 HISV K Q+ S+I +Y+N G Sbjct: 162 HISVAQKLQKEIPNSIILDQYTNPG 186 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 3.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Query: 4 QSIDRESLAARLVDATLATVRLPFYEMWDDV 34 Q+I E L+D LP E+WD + Sbjct: 32 QTIFNEDKLDNLMDKQFKNKSLPVIEIWDQM 62 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.133 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,893 Number of Sequences: 429 Number of extensions: 1027 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 195 length of database: 140,377 effective HSP length: 54 effective length of query: 141 effective length of database: 117,211 effective search space: 16526751 effective search space used: 16526751 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -