BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000738-TA|BGIBMGA000738-PA|undefined (195 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_04_0140 + 16572497-16572528,16572958-16573063,16573509-165735... 27 10.0 >01_04_0140 + 16572497-16572528,16572958-16573063,16573509-16573567, 16573615-16573681,16573964-16573989,16574787-16574913, 16576542-16576609,16577223-16577329,16577837-16577902, 16579332-16579438 Length = 254 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 137 ERALRTYLANRPITYTQKSKNQDQSLLHHISVGAKFQ 173 E LR YL RP +Q+S++ + +HH +V FQ Sbjct: 94 EENLRKYL--RPCLVSQESRSWSHANMHHANVVLSFQ 128 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.133 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,670,476 Number of Sequences: 37544 Number of extensions: 97133 Number of successful extensions: 153 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 153 Number of HSP's gapped (non-prelim): 1 length of query: 195 length of database: 14,793,348 effective HSP length: 78 effective length of query: 117 effective length of database: 11,864,916 effective search space: 1388195172 effective search space used: 1388195172 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -