BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000738-TA|BGIBMGA000738-PA|undefined (195 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15393| Best HMM Match : Peptidase_M16_C (HMM E-Value=6.6e-05) 31 0.83 SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 >SB_15393| Best HMM Match : Peptidase_M16_C (HMM E-Value=6.6e-05) Length = 683 Score = 30.7 bits (66), Expect = 0.83 Identities = 17/65 (26%), Positives = 32/65 (49%) Query: 120 RRNKGQRVEPPRAQTWGERALRTYLANRPITYTQKSKNQDQSLLHHISVGAKFQRYHTKS 179 R +K +++ + WGE R Y +R TY+ + Q+++ L ISV + ++ Sbjct: 515 RLDKPKKLRTETQKHWGEILTRQYNFDRACTYSGRGDLQERTTLASISVSLRNAHNQVQT 574 Query: 180 LISRK 184 L S + Sbjct: 575 LDSNE 579 >SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 122 NKGQRVEPPRAQTWGERALRTYLANRPITYTQKSKNQD 159 N ++ EP G+ L T AN+P+ +T ++KN D Sbjct: 672 NSRKKTEPANCTVSGD-GLTTGAANQPVKFTVRTKNPD 708 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.133 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,355,535 Number of Sequences: 59808 Number of extensions: 117361 Number of successful extensions: 248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 247 Number of HSP's gapped (non-prelim): 2 length of query: 195 length of database: 16,821,457 effective HSP length: 78 effective length of query: 117 effective length of database: 12,156,433 effective search space: 1422302661 effective search space used: 1422302661 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -