BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000737-TA|BGIBMGA000737-PA|undefined (194 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 28 0.051 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 5.9 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 5.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.8 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 7.8 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.8 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.8 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.8 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.8 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.8 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 7.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 7.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 7.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 7.8 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 7.8 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 28.3 bits (60), Expect = 0.051 Identities = 17/64 (26%), Positives = 30/64 (46%) Query: 65 ENRMRISDKILESVGIGHSEVSSARRALQDNEERTEKRIARRLEDNSLTKWTALKSGEEE 124 ++R +S ++ I HSE S+ + +EE E++ LE K + G+E Sbjct: 730 QHRDSLSPRVENRSAIVHSEASANANSSTSSEESREEKATTSLEAEKREKSEHCEKGKEY 789 Query: 125 SAAA 128 AA+ Sbjct: 790 YAAS 793 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 56 DFENSVANLENRMRISDKILESV 78 DF NS+ EN++ SD + E + Sbjct: 545 DFWNSINFNENKLHTSDTLKEEL 567 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 56 DFENSVANLENRMRISDKILESV 78 DF NS+ EN++ SD + E + Sbjct: 545 DFWNSINFNENKLHTSDTLKEEL 567 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 137 RLSDLEDEMSELNERSAAREKRVARLR 163 + L +E SE++ RS +E+R+ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRR 40 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.124 0.320 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,695 Number of Sequences: 429 Number of extensions: 1306 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of query: 194 length of database: 140,377 effective HSP length: 54 effective length of query: 140 effective length of database: 117,211 effective search space: 16409540 effective search space used: 16409540 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -