BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000736-TA|BGIBMGA000736-PA|undefined (99 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ341187-1|ABC68221.1| 2129|Homo sapiens dedicator of cytokinesi... 29 1.7 DQ118680-1|AAZ38452.1| 1990|Homo sapiens dedicator of cytokinesi... 29 1.7 DQ118679-1|AAZ38451.1| 1992|Homo sapiens dedicator of cytokinesi... 29 1.7 AL451044-2|CAI13105.1| 1302|Homo sapiens dedicator of cytokinesi... 29 1.7 AL451044-1|CAI13104.1| 2109|Homo sapiens dedicator of cytokinesi... 29 1.7 AL138847-2|CAI22995.1| 2109|Homo sapiens dedicator of cytokinesi... 29 1.7 AK125049-1|BAC86032.1| 1520|Homo sapiens protein ( Homo sapiens ... 29 1.7 AK055905-1|BAB71042.1| 741|Homo sapiens protein ( Homo sapiens ... 29 1.7 AB051558-1|BAB21862.1| 1302|Homo sapiens KIAA1771 protein protein. 29 1.7 EF063608-1|ABN79919.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 EF063607-1|ABN79918.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 EF063606-1|ABN79917.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 EF063605-1|ABN79916.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 EF063604-1|ABN79915.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 EF063603-1|ABN79914.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 EF063602-1|ABN79913.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 EF063601-1|ABN79912.1| 139|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 AL834283-1|CAD38957.1| 335|Homo sapiens hypothetical protein pr... 28 4.0 AF105378-1|AAD30210.2| 456|Homo sapiens heparan sulfate 3-O-sul... 28 4.0 Y15758-1|CAC17466.1| 683|Homo sapiens LB1 protein. 27 9.3 BC130296-1|AAI30297.1| 682|Homo sapiens cytoskeleton associated... 27 9.3 AY062261-1|AAL47212.1| 682|Homo sapiens tumor-associated microt... 27 9.3 AL359513-5|CAH71660.2| 682|Homo sapiens cytoskeleton associated... 27 9.3 AK001611-1|BAA91788.1| 349|Homo sapiens protein ( Homo sapiens ... 27 9.3 AJ429398-1|CAD22295.1| 683|Homo sapiens cytoskeleton associated... 27 9.3 AF177227-1|AAG33675.1| 572|Homo sapiens CTCL tumor antigen se20... 27 9.3 >DQ341187-1|ABC68221.1| 2129|Homo sapiens dedicator of cytokinesis 7 protein. Length = 2129 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 1250 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 1285 >DQ118680-1|AAZ38452.1| 1990|Homo sapiens dedicator of cytokinesis 7 protein. Length = 1990 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 1111 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 1146 >DQ118679-1|AAZ38451.1| 1992|Homo sapiens dedicator of cytokinesis 7 protein. Length = 1992 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 1111 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 1146 >AL451044-2|CAI13105.1| 1302|Homo sapiens dedicator of cytokinesis 7 protein. Length = 1302 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 421 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 456 >AL451044-1|CAI13104.1| 2109|Homo sapiens dedicator of cytokinesis 7 protein. Length = 2109 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 1219 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 1254 >AL138847-2|CAI22995.1| 2109|Homo sapiens dedicator of cytokinesis 7 protein. Length = 2109 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 1219 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 1254 >AK125049-1|BAC86032.1| 1520|Homo sapiens protein ( Homo sapiens cDNA FLJ43059 fis, clone BRTHA3007769. ). Length = 1520 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 630 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 665 >AK055905-1|BAB71042.1| 741|Homo sapiens protein ( Homo sapiens cDNA FLJ31343 fis, clone MESAN1000101, weakly similar to Rat trg gene product. ). Length = 741 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 78 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 113 >AB051558-1|BAB21862.1| 1302|Homo sapiens KIAA1771 protein protein. Length = 1302 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 61 METPNDELFDFRGARAQRGRPLSSALEDDEFNEDAMV 97 MET +L+DF QRGRP+ A +D E +M+ Sbjct: 421 METV-PQLYDFTETHNQRGRPICIATDDYESESGSMI 456 >EF063608-1|ABN79919.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >EF063607-1|ABN79918.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >EF063606-1|ABN79917.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >EF063605-1|ABN79916.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >EF063604-1|ABN79915.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >EF063603-1|ABN79914.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >EF063602-1|ABN79913.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >EF063601-1|ABN79912.1| 139|Homo sapiens heparan sulfate 3-O-sulfotransferase 4 protein. Length = 139 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 54 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 103 >AL834283-1|CAD38957.1| 335|Homo sapiens hypothetical protein protein. Length = 335 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 112 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 161 >AF105378-1|AAD30210.2| 456|Homo sapiens heparan sulfate 3-O-sulfotransferase-4 protein. Length = 456 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 13 YDCNYNKGESYYRPVLDR-LDGKAPIVREPERESIRADVDNRIKSALHDME 62 +D NY KG +YR V+ + LDG+ + + P + + RI S D++ Sbjct: 233 FDRNYEKGLEWYRNVMPKTLDGQITMEKTPS-YFVTNEAPKRIHSMAKDIK 282 >Y15758-1|CAC17466.1| 683|Homo sapiens LB1 protein. Length = 683 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 29 DRLDGKAPIVREPERESIRADVDNRIKSALHDMETPNDE 67 ++L+ ++ + R + + DN+ K HD++TPN E Sbjct: 545 EKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTE 583 >BC130296-1|AAI30297.1| 682|Homo sapiens cytoskeleton associated protein 2 protein. Length = 682 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 29 DRLDGKAPIVREPERESIRADVDNRIKSALHDMETPNDE 67 ++L+ ++ + R + + DN+ K HD++TPN E Sbjct: 544 EKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTE 582 >AY062261-1|AAL47212.1| 682|Homo sapiens tumor-associated microtubule-associated protein protein. Length = 682 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 29 DRLDGKAPIVREPERESIRADVDNRIKSALHDMETPNDE 67 ++L+ ++ + R + + DN+ K HD++TPN E Sbjct: 544 EKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTE 582 >AL359513-5|CAH71660.2| 682|Homo sapiens cytoskeleton associated protein 2 protein. Length = 682 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 29 DRLDGKAPIVREPERESIRADVDNRIKSALHDMETPNDE 67 ++L+ ++ + R + + DN+ K HD++TPN E Sbjct: 544 EKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTE 582 >AK001611-1|BAA91788.1| 349|Homo sapiens protein ( Homo sapiens cDNA FLJ10749 fis, clone NT2RP3001915. ). Length = 349 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 29 DRLDGKAPIVREPERESIRADVDNRIKSALHDMETPNDE 67 ++L+ ++ + R + + DN+ K HD++TPN E Sbjct: 211 EKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTE 249 >AJ429398-1|CAD22295.1| 683|Homo sapiens cytoskeleton associated protein 2 protein. Length = 683 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 29 DRLDGKAPIVREPERESIRADVDNRIKSALHDMETPNDE 67 ++L+ ++ + R + + DN+ K HD++TPN E Sbjct: 545 EKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTE 583 >AF177227-1|AAG33675.1| 572|Homo sapiens CTCL tumor antigen se20-10 protein. Length = 572 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/39 (28%), Positives = 22/39 (56%) Query: 29 DRLDGKAPIVREPERESIRADVDNRIKSALHDMETPNDE 67 ++L+ ++ + R + + DN+ K HD++TPN E Sbjct: 508 EKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTE 546 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.318 0.136 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,434,500 Number of Sequences: 224733 Number of extensions: 496452 Number of successful extensions: 1143 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 1127 Number of HSP's gapped (non-prelim): 26 length of query: 99 length of database: 73,234,838 effective HSP length: 76 effective length of query: 23 effective length of database: 56,155,130 effective search space: 1291567990 effective search space used: 1291567990 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -