BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000735-TA|BGIBMGA000735-PA|undefined (293 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1124 + 30559633-30559674,30559781-30559890,30559973-305600... 29 3.4 >03_05_1124 + 30559633-30559674,30559781-30559890,30559973-30560030, 30560455-30560718,30560803-30560940,30561264-30561315, 30561525-30561604,30561929-30561988,30562084-30562164, 30562299-30562376,30563548-30563676,30563896-30564039, 30564145-30564290,30564402-30564558,30564657-30564715, 30564800-30564959,30565054-30565203,30565309-30565445, 30565531-30565677,30565995-30566052,30566417-30566518, 30566590-30566627,30566846-30566972,30567053-30567223, 30567313-30567444,30567575-30567681,30567815-30567875, 30567970-30568147,30568245-30568450,30568781-30568879, 30569021-30569236,30569333-30569472,30569559-30569660, 30569747-30569861,30570129-30570194,30570323-30570480, 30570594-30570690,30570931-30571137,30571435-30571505, 30571648-30571747,30571836-30571892,30571969-30572025, 30572108-30572188,30572319-30572401,30572504-30572651 Length = 1722 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/57 (26%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 9 MVQQSKKKDILKEAAQYFTRTVDELECEIKEFLGLPVDASDIKDYELKSDLQNIIRE 65 ++Q++++ LKEA + V+EL + L +D + K E+ S+L+++++E Sbjct: 1122 IIQEARETGALKEAKDKLEKRVEELTWRLDVEKHLRIDLEEAKGQEI-SNLKSVLQE 1177 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.131 0.356 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,774,632 Number of Sequences: 37544 Number of extensions: 182657 Number of successful extensions: 485 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 485 Number of HSP's gapped (non-prelim): 1 length of query: 293 length of database: 14,793,348 effective HSP length: 81 effective length of query: 212 effective length of database: 11,752,284 effective search space: 2491484208 effective search space used: 2491484208 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -