BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000733-TA|BGIBMGA000733-PA|IPR001173|Glycosyl transferase, family 2, IPR000772|Ricin B lectin, IPR008997|Ricin B-related lectin (589 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 4.5 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 23 7.8 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.4 bits (48), Expect = 4.5 Identities = 16/72 (22%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Query: 39 KDLLSDQPRDVEETLSKTMWKYQDYKRQSEYRRKVMLKEKFAKQQAIKMSKKTENDLEEQ 98 +D + D +ETL K D + R V+ K F K + +KT + + Sbjct: 270 RDAFLKEVADFQETLKKISQFQLDAHEFACLRAIVLFKTSFEKPSSSSNQEKTTTE-SAK 328 Query: 99 FGLIRNSEDLRI 110 +I++ +R+ Sbjct: 329 ISVIQDDAQMRL 340 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 316 YSARAVTPVIDVINADTFEYSPS 338 Y A++ V+DVIN T+++ S Sbjct: 184 YDVPAMSNVLDVINVMTYDFHGS 206 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,268 Number of Sequences: 317 Number of extensions: 6113 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 589 length of database: 114,650 effective HSP length: 61 effective length of query: 528 effective length of database: 95,313 effective search space: 50325264 effective search space used: 50325264 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -