BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000730-TA|BGIBMGA000730-PA|undefined (40 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1105.02c |lys4||homocitrate synthase |Schizosaccharomyces po... 25 1.2 SPAC6B12.14c |||conserved fungal protein|Schizosaccharomyces pom... 24 2.9 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 23 3.8 >SPBC1105.02c |lys4||homocitrate synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 418 Score = 25.0 bits (52), Expect = 1.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 9 VSQGQTTEVTKLPPNPRRKGPNPLESILKADD 40 VS+ TE K P N GPNP + + + ++ Sbjct: 3 VSEANGTETIKPPMNGNPYGPNPSDFLSRVNN 34 >SPAC6B12.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 154 Score = 23.8 bits (49), Expect = 2.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Query: 2 ACLEVTQVSQGQTTEVTK 19 A L VTQ+ Q TTEV K Sbjct: 31 AALSVTQLYQASTTEVLK 48 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 23.4 bits (48), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 19 KLPPNPRRKGPNPLESILKA 38 KLPP + +PLE IL+A Sbjct: 1952 KLPPASNNRKVDPLEDILQA 1971 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.309 0.128 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,985 Number of Sequences: 5004 Number of extensions: 3677 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 3 length of query: 40 length of database: 2,362,478 effective HSP length: 21 effective length of query: 19 effective length of database: 2,257,394 effective search space: 42890486 effective search space used: 42890486 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -