SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000730-TA|BGIBMGA000730-PA|undefined
         (40 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P...    25   9.9  

>AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-PA
           protein.
          Length = 1377

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 3   CLEVTQVSQGQTTEVTKLPPNPRRKGPNPLESI 35
           CL+    + G    V  LPP P RK P  LE++
Sbjct: 473 CLQHAPAT-GPWQTVQSLPPRPNRKPPAGLENL 504


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.309    0.128    0.367 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,245,532
Number of Sequences: 52641
Number of extensions: 52177
Number of successful extensions: 140
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 140
Number of HSP's gapped (non-prelim): 1
length of query: 40
length of database: 24,830,863
effective HSP length: 21
effective length of query: 19
effective length of database: 23,725,402
effective search space: 450782638
effective search space used: 450782638
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.7 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -