GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000730-TA|BGIBMGA000730-PA|undefined
         (40 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8YPD1 Cluster: Alr4267 protein; n=6; Cyanobacteria|Rep...    31   6.0  

>UniRef50_Q8YPD1 Cluster: Alr4267 protein; n=6; Cyanobacteria|Rep:
           Alr4267 protein - Anabaena sp. (strain PCC 7120)
          Length = 844

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 1   MACLEVTQVSQGQTTEVTKLP-PNPRRKGPNPLESILKA 38
           +A L++ Q   GQ + +T+ P PNP+   PNPL   L+A
Sbjct: 454 LAALQL-QAGAGQRSNITQSPIPNPQSPIPNPLNDSLEA 491


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.309    0.128    0.367 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,952,139
Number of Sequences: 1657284
Number of extensions: 992226
Number of successful extensions: 2579
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2579
Number of HSP's gapped (non-prelim): 1
length of query: 40
length of database: 575,637,011
effective HSP length: 21
effective length of query: 19
effective length of database: 540,834,047
effective search space: 10275846893
effective search space used: 10275846893
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.7 bits)
S2: 65 (30.3 bits)