BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000730-TA|BGIBMGA000730-PA|undefined (40 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8YPD1 Cluster: Alr4267 protein; n=6; Cyanobacteria|Rep... 31 6.0 >UniRef50_Q8YPD1 Cluster: Alr4267 protein; n=6; Cyanobacteria|Rep: Alr4267 protein - Anabaena sp. (strain PCC 7120) Length = 844 Score = 30.7 bits (66), Expect = 6.0 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Query: 1 MACLEVTQVSQGQTTEVTKLP-PNPRRKGPNPLESILKA 38 +A L++ Q GQ + +T+ P PNP+ PNPL L+A Sbjct: 454 LAALQL-QAGAGQRSNITQSPIPNPQSPIPNPLNDSLEA 491 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.309 0.128 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,952,139 Number of Sequences: 1657284 Number of extensions: 992226 Number of successful extensions: 2579 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2579 Number of HSP's gapped (non-prelim): 1 length of query: 40 length of database: 575,637,011 effective HSP length: 21 effective length of query: 19 effective length of database: 540,834,047 effective search space: 10275846893 effective search space used: 10275846893 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -