BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000729-TA|BGIBMGA000729-PA|IPR000886|Endoplasmic reticulum targeting sequence, IPR002018|Carboxylesterase, type B (172 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 26 0.17 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 1.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 1.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 1.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 1.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 1.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 2.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.1 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 2.8 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 6.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.6 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 8.6 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 26.2 bits (55), Expect = 0.17 Identities = 21/99 (21%), Positives = 45/99 (45%), Gaps = 2/99 (2%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKITELWSNFVKHGDPTPPNFKGEITWPPVSANK 126 +F E + +V K+NK E+H D V + I + + K+ + + + ++++ Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNIKKSGNESKKYA-TSSNSLRSRTHGFQHTSSR 230 Query: 127 YNMLLIGNKFRIIEPRKEQEMFSFWSDIYEKYFNPKTCH 165 Y+ ++ R E RK+ + + EK+ +T H Sbjct: 231 YSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSH 269 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 LF E + +V K+NK E+H D V + I Sbjct: 173 LFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 LF E + +V K+NK E+H D V + I Sbjct: 162 LFEREEIKNVLTKINKIEEH-DTVLVVNI 189 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 LF E + +V K+NK E+H D V + I Sbjct: 173 LFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 LF E + +V K+NK E+H D V + I Sbjct: 162 LFEREEIKNVLTKINKIEEH-DTVLVVNI 189 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 1.6 Identities = 22/102 (21%), Positives = 45/102 (44%), Gaps = 3/102 (2%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKITELWSNFVKHGDPTPPNFKGEITWPPVSANK 126 +F E + +V K+NK E+H D V + I + + K+ + + + ++++ Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNIKKSGNESKKYA-TSSNSLRSRTHGFQHTSSR 230 Query: 127 YNMLLIGNKFRIIEPRKEQEMFSFWSDIYEKYFNPKT-CHNY 167 Y+ ++ R E RK+ + + EK +T C Y Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRY 272 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 162 IFEREEIKNVLTKINKIEEH-DTVLVVNI 189 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 162 IFEREEIKNVLTKINKIEEH-DTVLVVNI 189 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 162 IFEREEIKNVLTKINKIEEH-DTVLVVNI 189 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 67 LFNCEPLVDVYVKVNKDEKHRDRVFIKKI 95 +F E + +V K+NK E+H D V + I Sbjct: 173 IFEREEIKNVLTKINKIEEH-DTVLVVNI 200 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 140 EPRKEQEMFSFWSDIYEKYFN 160 EPR ++E+ D E+YF+ Sbjct: 58 EPRSKEEILLHAKDFLEQYFS 78 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.0 bits (42), Expect = 6.5 Identities = 5/17 (29%), Positives = 14/17 (82%) Query: 71 EPLVDVYVKVNKDEKHR 87 EP++D+ ++++K+ K + Sbjct: 3 EPMIDITMEISKNHKEQ 19 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 12 YPIFKFVKTHYKKFKNNVFLY 32 + I+K + +Y K+K N+ Y Sbjct: 418 FSIYKTILDYYHKYKENLPKY 438 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 12 YPIFKFVKTHYKKFKNNVFLY 32 + I+K + +Y K+K N+ Y Sbjct: 44 FSIYKTILDYYHKYKENLPKY 64 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.140 0.445 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,475 Number of Sequences: 429 Number of extensions: 2833 Number of successful extensions: 22 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of query: 172 length of database: 140,377 effective HSP length: 54 effective length of query: 118 effective length of database: 117,211 effective search space: 13830898 effective search space used: 13830898 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -