BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000727-TA|BGIBMGA000727-PA|IPR001841|Zinc finger, RING-type, IPR003111|Peptidase S16, lon N-terminal (371 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 176 3e-44 SB_57670| Best HMM Match : LON (HMM E-Value=6.8e-07) 134 8e-32 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 62 7e-10 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 46 7e-05 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 44 2e-04 SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) 44 3e-04 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 43 5e-04 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 43 5e-04 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 43 5e-04 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 42 6e-04 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 42 8e-04 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 41 0.001 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 41 0.001 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 40 0.002 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 40 0.002 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 40 0.004 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 39 0.006 SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) 39 0.008 SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) 38 0.010 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 38 0.010 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 38 0.010 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 38 0.017 SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 38 0.017 SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) 37 0.023 SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 37 0.023 SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 37 0.023 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 37 0.023 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 37 0.023 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 37 0.030 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 37 0.030 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 36 0.040 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 36 0.053 SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) 36 0.053 SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) 36 0.053 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.053 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 36 0.053 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 36 0.053 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 36 0.070 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 36 0.070 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 36 0.070 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 36 0.070 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 36 0.070 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 36 0.070 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 36 0.070 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 36 0.070 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.093 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.093 SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.093 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 35 0.093 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.093 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.093 SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.093 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 35 0.093 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 35 0.093 SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.093 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 35 0.093 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.093 SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) 35 0.12 SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 35 0.12 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 35 0.12 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 35 0.12 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) 34 0.16 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) 34 0.16 SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) 34 0.21 SB_12595| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 34 0.21 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 34 0.21 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 33 0.28 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 33 0.37 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 33 0.49 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 33 0.49 SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) 33 0.49 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 33 0.49 SB_54922| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0028) 33 0.49 SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) 33 0.49 SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 32 0.65 SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.65 SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) 32 0.65 SB_32622| Best HMM Match : Ank (HMM E-Value=2.2e-05) 32 0.65 SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) 32 0.65 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.86 SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.86 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 32 0.86 SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) 32 0.86 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 31 1.1 SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) 31 1.5 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_56038| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_17267| Best HMM Match : WSC (HMM E-Value=2e-12) 30 2.6 SB_37013| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) 29 4.6 SB_26072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) 29 4.6 SB_6012| Best HMM Match : UBA (HMM E-Value=4.8e-05) 29 4.6 SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 29 6.1 SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 29 6.1 SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_1522| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_58016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_48253| Best HMM Match : zf-C3HC4 (HMM E-Value=0.12) 29 6.1 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_25458| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 29 6.1 SB_5186| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) 29 8.0 SB_36807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_8245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.0 SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) 29 8.0 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 29 8.0 SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) 29 8.0 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 176 bits (428), Expect = 3e-44 Identities = 96/260 (36%), Positives = 137/260 (52%), Gaps = 12/260 (4%) Query: 54 RKEAASSWLKSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLN-- 111 R+E+A + + C LCC +PVTTPCGH +CR C+ RS+D+ C +C L Sbjct: 365 RQESAME-MTVEEFECTLCCRLFYNPVTTPCGHVFCRACLNRSLDHRPGCPICRSSLTQN 423 Query: 112 -----DFDLSTTGGTIFIRAMLA---SVGALRXXXXXXXNVMPIFICTVAYPSIPCPLFI 163 + L T + L + L +P+F+CT+A+P IPCPL I Sbjct: 424 VTVAIEMLLKTFFPKDYEDRKLQHEEDMAMLASIASNTSEEIPVFVCTLAFPLIPCPLHI 483 Query: 164 FDPRYRLMVRRVLESETRKFGMVACERNGGGSEYGTILQVCDCIHMEDGRSILSTVGVSR 223 F+PRYRLMVR+ +ES R+FGM + SE+GT+L+V + ++ DGRS + TVG R Sbjct: 484 FEPRYRLMVRQCMESGARQFGMCMYDDEHDFSEFGTMLEVREVRYLPDGRSFVDTVGGRR 543 Query: 224 FRVLETGVRDGYDIARVQVITDLIPEDSIQICDLRVTAVHICYKALSWLNSMHETVYSEI 283 F+VL G+RDGY +ARV+ I D +P + DL+ + +A W NS+ V I Sbjct: 544 FKVLSRGMRDGYSVARVEWIQD-VPVSEEHLPDLKEFHRAVYDQASRWFNSLPLLVRRRI 602 Query: 284 VSAFGNMPQMDETWWRTPDG 303 V +MP P G Sbjct: 603 VQTVSDMPAWQNDTETLPHG 622 Score = 53.6 bits (123), Expect = 2e-07 Identities = 29/73 (39%), Positives = 38/73 (52%), Gaps = 5/73 (6%) Query: 43 RRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK 102 +RLT F A K++ KS ++CV CC L+ P T PCGHT C C+ +S K Sbjct: 78 KRLTD--FHARNKQSTLE-TKSRILSCVRCCGILLGPCTLPCGHTVCEKCLSKSQAK--K 132 Query: 103 CALCLRPLNDFDL 115 C C + FDL Sbjct: 133 CVDCGEDYSSFDL 145 >SB_57670| Best HMM Match : LON (HMM E-Value=6.8e-07) Length = 224 Score = 134 bits (325), Expect = 8e-32 Identities = 69/205 (33%), Positives = 118/205 (57%), Gaps = 2/205 (0%) Query: 145 MPIFICTVAYPSIPCPLFIFDPRYRLMVRRVLESETRKFGMVAC--ERNGGGSEYGTILQ 202 +PIFICT+A+P++ CPL IF+PRYRLM+RR +ES +R+FGM + + + +GT+L+ Sbjct: 9 IPIFICTLAFPTVQCPLHIFEPRYRLMIRRCVESGSRRFGMCTAGDDPSKPFATFGTMLK 68 Query: 203 VCDCIHMEDGRSILSTVGVSRFRVLETGVRDGYDIARVQVITDLIPEDSIQICDLRVTAV 262 + D +++DGRSI++T+G RF V ++DGY +A+V+ + D + ED + +++ + Sbjct: 69 IKDVQYLQDGRSIINTIGTRRFSVQSYNMKDGYYVAKVKWVKDDVEEDVEEKAEIQKATL 128 Query: 263 HICYKALSWLNSMHETVYSEIVSAFGNMPQMDETWWRTPDGXXXXXXXXXXXXXRTEIKV 322 W NS++E I A G MP D DG + + K+ Sbjct: 129 TGFAMLQLWFNSLNEEQQKCITDAIGPMPNCDPNMHVQQDGPEWVWWSLAALPLQDKPKL 188 Query: 323 LILSTRCLMKRLTAVSRTLEAIDQI 347 +IL+ + ++RL ++ R L + Q+ Sbjct: 189 IILAMKSTIERLRSIQRFLMLMIQM 213 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 62.1 bits (144), Expect = 7e-10 Identities = 23/56 (41%), Positives = 37/56 (66%) Query: 55 KEAASSWLKSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPL 110 + AS+ + D C LC + L++PVT+ CGH++CR C+ RS+D+ ++C C PL Sbjct: 316 RSPASNTEQLDDFECKLCFNLLLEPVTSLCGHSFCRDCLYRSLDHRVECPCCRAPL 371 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 19/32 (59%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 +S C LC VDPVT CGHTYC C++ Sbjct: 16 RSRFFECGLCGDFYVDPVTILCGHTYCLACIK 47 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 45.6 bits (103), Expect = 7e-05 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVERSM-DYNIKCALC 106 D C +C LV+PV PC H +C+ C +++ + N++C +C Sbjct: 34 DFTCPICLQLLVEPVVLPCEHEFCKMCFTQNVQEANLQCPMC 75 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/41 (39%), Positives = 24/41 (58%) Query: 65 SDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCAL 105 SD+ C LC DP C HTYCR C+E ++++ +C + Sbjct: 13 SDVTCSLCLGQYQDPRVLACLHTYCRHCLESLVEHSKECTV 53 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/41 (39%), Positives = 24/41 (58%) Query: 65 SDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCAL 105 SD+ C LC DP C HTYCR C+E ++++ +C + Sbjct: 22 SDVTCSLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTV 62 >SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) Length = 474 Score = 43.6 bits (98), Expect = 3e-04 Identities = 14/38 (36%), Positives = 24/38 (63%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALC 106 C C + + DP PC H+ C+TC+E+ ++ +KC +C Sbjct: 19 CPACSNVIKDPRILPCLHSICKTCLEKQLNGCLKCPVC 56 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 42.7 bits (96), Expect = 5e-04 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 65 SDINCVLCCSTLVDPVTTPCGHTYCRTC----VERSMDYNIKCALC 106 SD+ C LC DP C HTYCR C VE S + + C C Sbjct: 13 SDVTCSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSCPQC 58 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 42.7 bits (96), Expect = 5e-04 Identities = 15/40 (37%), Positives = 23/40 (57%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCAL 105 D+ C LC DP C HTYCR C+E ++++ +C + Sbjct: 13 DVTCCLCLEQYQDPRVLACLHTYCRHCLESLVEHSKECTV 52 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 42.7 bits (96), Expect = 5e-04 Identities = 13/32 (40%), Positives = 21/32 (65%) Query: 64 SSDINCVLCCSTLVDPVTTPCGHTYCRTCVER 95 S D C +C + DP+ T CGH+YC+ C+++ Sbjct: 25 SDDSMCAICHIVVKDPILTSCGHSYCKCCIQK 56 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 42.7 bits (96), Expect = 5e-04 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 65 SDINCVLCCSTLVDPVTTPCGHTYCRTC----VERSMDYNIKCALC 106 SD+ C LC DP C HTYCR C VE S + + C C Sbjct: 13 SDVTCSLCLEQYQDPRVLACLHTYCRHCLESLVEHSQERTVSCPQC 58 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 42.3 bits (95), Expect = 6e-04 Identities = 14/29 (48%), Positives = 18/29 (62%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 D+ C+LC DP PC HTYC+ C+E Sbjct: 13 DVTCLLCLDIFTDPRLLPCLHTYCKKCLE 41 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/44 (34%), Positives = 25/44 (56%) Query: 68 NCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLN 111 +C +C PV PCGH +C C++ + KCA+C +P++ Sbjct: 70 DCPVCLQQASYPVRLPCGHMFCFLCIKGVALRSRKCAICRQPIS 113 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query: 67 INCVLCCSTLVDPVTT-PCGHTYCRTCVERSMDYNIKCALC 106 I CVLC LVD T C H++CR C+ R ++ + +C +C Sbjct: 46 IICVLCGGYLVDATTIIECLHSFCRCCIVRYLETSYRCPVC 86 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLNDFDL 115 D C +C L DP+ T CGH +C C+ + N C L L DL Sbjct: 54 DFKCGICFGVLEDPLVTTCGHVFCSQCLVHWIAENGTCPLTCEQLAIDDL 103 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query: 67 INCVLCCSTLVDPVTT-PCGHTYCRTCVERSMDYNIKCALC 106 I CVLC LVD T C H++CR C+ R ++ + +C +C Sbjct: 14 IICVLCGGYLVDATTIIECLHSFCRCCIVRYLETSYRCPVC 54 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/38 (36%), Positives = 20/38 (52%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALC 106 C++C T +PV T C H +C C + N KC +C Sbjct: 245 CIMCRKTFKNPVVTKCLHYFCEACALQHYKKNSKCFVC 282 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK----CALC 106 ++ C +C DP PC HT+CR C+E +++ K C LC Sbjct: 12 EVTCAICIEHFTDPRLLPCLHTFCRHCLEDLAEHSGKGKLVCPLC 56 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCV----ERSMDYNIKCALC 106 D+ C LC DP C HTYCR C+ E S +I C C Sbjct: 13 DVTCCLCLEQYQDPRVLACLHTYCRHCLESLAEHSQGDSISCPQC 57 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 64 SSDINCVLCCSTLVDPVTTPCGHTYCRTCV 93 S + C LC DPV T CGHT+C+ C+ Sbjct: 189 SPKLFCPLCRRVFKDPVITSCGHTFCQACI 218 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Query: 55 KEAASSWLKSSDINCVLCCSTLVDPVTTP---CGHTYCRTCVERSMDYNIKCALCLRPL- 110 + AA + +C +C T CGH YC C+ R ++ N C +C +P Sbjct: 248 RNAAKGKKRYESKSCPICLEEFTPETPTRLLVCGHKYCEPCLSRWLENNTTCPICRKPTS 307 Query: 111 -NDFDLST 117 ND +L + Sbjct: 308 RNDDELGS 315 >SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 39.1 bits (87), Expect = 0.006 Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALC 106 C +CC+ + PC H CR+C+ R + N +C C Sbjct: 430 CPICCAMRISVRFLPCRHVSCRSCITRHLMNNKECFFC 467 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 38.7 bits (86), Expect = 0.008 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 10/84 (11%) Query: 24 QARVLLTQAIAVLIQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVT-T 82 + V+ T + L++ R GR++ R R K+ + I CVLC LVD T Sbjct: 1330 RGEVVETGSPTELLERRAGRKMLR---RMALKDL------NPHIICVLCGGYLVDATTIV 1380 Query: 83 PCGHTYCRTCVERSMDYNIKCALC 106 C H++CR+C+ + + C +C Sbjct: 1381 ECLHSFCRSCIVSWLQASYHCPVC 1404 >SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) Length = 1071 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTCVERSMD-----YNIKCALC 106 I C C T+ DPV PC + CR+C ++S +N+ C LC Sbjct: 117 ITCPSCKETMNDPVLLPCLDSICRSCCQKSAQKHGNMWNVLCRLC 161 >SB_18762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K+ + +C +C L P+++ C H+ C C E + D K C +C L D Sbjct: 19 KNEEFHCAICLDVLEKPLSSKCQHSCCSDCWESAFDLGEKHPACPICQETLAD 71 >SB_14207| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0048) Length = 233 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Query: 23 RQARVLLTQAIAVLIQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLV-DPVT 81 + +++L + ++ +++ +L L + + K ++ +CC LV PVT Sbjct: 58 KASQILSDEQKGLIAEDKENVKLWEELLTDTTLDYTAFHQKVEELFACVCCQDLVLYPVT 117 Query: 82 TPCGHTYCRTCVERSMDYNI-KCALC 106 T C H C+ C++RS + C C Sbjct: 118 TKCLHNICKGCLQRSFKAEVFTCPYC 143 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 69 CVLCCSTLVDPVTTP-CGHTYCRTCVERSMDYNIKCALCLRP 109 C +C T+ P T CGHT+CR C+ + + C C P Sbjct: 678 CPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTCRDP 719 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 69 CVLCCSTLVDPVTTP-CGHTYCRTCVERSMDYNIKCALCLRP 109 C +C T+ P T CGHT+CR C+ + + C C P Sbjct: 753 CPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTCRDP 794 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 37.5 bits (83), Expect = 0.017 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVER---SMDYNIKCALC 106 ++ C +C +P PC HT+C+ C+E+ S N+ C C Sbjct: 19 ELTCSVCLEQFREPKMLPCFHTFCKECLEKTKQSFRGNLLCPTC 62 >SB_16517| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 306 Score = 37.5 bits (83), Expect = 0.017 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK 102 C +C L V TPCGH++C C+E M+ ++ Sbjct: 18 CGICAEVLERAVLTPCGHSFCGVCLETWMNAKLE 51 >SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) Length = 169 Score = 37.1 bits (82), Expect = 0.023 Identities = 29/83 (34%), Positives = 37/83 (44%), Gaps = 13/83 (15%) Query: 43 RRLTRVLFRAVRKEAASSWLKSSDIN----CVLCCSTLVDPVT-TPCGHTYCRTCV---- 93 R F A KE LK SD+N C LC L+ P T T C HT+C++C+ Sbjct: 37 RNAENPFFAASNKERT---LKLSDLNPFITCGLCEGYLIKPTTITECLHTFCKSCIVTYL 93 Query: 94 ERSMDYNI-KCALCLRPLNDFDL 115 + S D C + N FDL Sbjct: 94 QDSEDNTCPSCNTVIHETNPFDL 116 >SB_7987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMD--YNIK-CALC 106 C +C L P+ TPC H +C C+ +D YN C +C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVC 200 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 37.1 bits (82), Expect = 0.023 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 65 SDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLND 112 S+ C C + P+ T CGH C C + ++ C LC + + + Sbjct: 14 SEFLCSYCRKVYLHPLVTGCGHVLCTKCYNKRSKKHLGCPLCGKSMGE 61 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query: 45 LTRVLFRAVRKEAASSWLKSSD-INCVLCCSTLVDPVTTPCGHTYCRTCVE 94 + R+L + + A S+ + D + C LC DP PC H++CR C+E Sbjct: 110 MDRILSFFLEEMATSASRRLEDEVTCSLCIEHFNDPRVLPCLHSFCRHCLE 160 >SB_57688| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 262 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMD--YNIK-CALC 106 C +C L P+ TPC H +C C+ +D YN C +C Sbjct: 34 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVC 74 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMD--YNIK-CALC 106 C +C L P+ TPC H +C C+ +D YN C +C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVC 200 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMD--YNIK-CALC 106 C +C L P+ TPC H +C C+ +D YN C +C Sbjct: 160 CAICKEVLTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVC 200 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/43 (37%), Positives = 21/43 (48%) Query: 52 AVRKEAASSWLKSSDINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 A +E S + C +C + L D PC HTYCR C+E Sbjct: 128 ATHRETGSQDDIRQQLACGICHALLRDARVLPCLHTYCRRCIE 170 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 36.7 bits (81), Expect = 0.030 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C L DP PC H++CR C+E Sbjct: 12 EVTCSICIEHLNDPRVLPCLHSFCRHCLE 40 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 36.3 bits (80), Expect = 0.040 Identities = 11/26 (42%), Positives = 18/26 (69%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVE 94 C +C L + +TT CGH++C +C+E Sbjct: 18 CNICVGVLENAITTICGHSFCESCLE 43 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 36.3 bits (80), Expect = 0.040 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Query: 56 EAASSWLKSSDINCVLCCSTLVDP-VTTPCGHTYCRTCVERSMDYN----IKCALCLR 108 E+ S + S ++ C +C L +P T C H C+ C++R M +N I+C C R Sbjct: 4 ESHLSQVFSEELTCPVCLEELKEPKCLTSCAHNVCKPCLDR-MTFNGEKEIRCPTCRR 60 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 36.3 bits (80), Expect = 0.040 Identities = 16/62 (25%), Positives = 26/62 (41%) Query: 55 KEAASSWLKSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLNDFD 114 + + W C +C T DP PC H++C+ CV + + +C DF Sbjct: 391 RHGTTFWCIKMSTICGVCRETYTDPRVAPCLHSFCKECVTKLVTERQGKFVCPDCQADFQ 450 Query: 115 LS 116 +S Sbjct: 451 MS 452 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 36.3 bits (80), Expect = 0.040 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C LC DP PC H++CR C+E Sbjct: 12 EVTCSLCIEHFNDPRVLPCFHSFCRHCLE 40 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 35.9 bits (79), Expect = 0.053 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C LC DP PC H++CR C+E Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLE 40 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 35.9 bits (79), Expect = 0.053 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 59 SSWLKSSDIN--CVLCCSTLVDPVTTPCGHTYCRTCVERSM---DYNIKCALC 106 S + S++N C LC +P PC HT+C+ C+E + + + C C Sbjct: 133 SPMMPGSNVNLFCPLCHEMFANPRLLPCLHTFCKRCLENLVPPRSHTLSCPSC 185 >SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 336 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Query: 66 DINCVLCCSTLVDPVTTP-CGHTYCRTCVERSMDYNIKCALC 106 D C +C + ++ PV P CGH+ C +C ER N KC C Sbjct: 53 DFICNVCGTVMLVPVVMPNCGHSCCSSCAER---VNRKCPEC 91 >SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 349 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Query: 66 DINCVLCCSTLVDPVTTP-CGHTYCRTCVERSMDYNIKCALC 106 D C +C + ++ PV P CGH+ C +C ER N KC C Sbjct: 53 DFICNVCGTVMLVPVVMPNCGHSCCSSCAER---VNRKCPEC 91 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 35.9 bits (79), Expect = 0.053 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C LC DP PC H++CR C+E Sbjct: 12 EVTCSLCIEHFNDPRVLPCLHSFCRHCLE 40 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 35.9 bits (79), Expect = 0.053 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSM 97 C +C L +P+ T CGH C +C E S+ Sbjct: 34 CTICKHVLQEPLQTTCGHRICESCFELSL 62 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYN---IKCALCLRPLNDFDL 115 C +C L DP T C H +C C+ ++ +C +C P+N +L Sbjct: 65 CPICLDPLDDPSITRCAHVFCTGCLTDVIENEGLAPRCPMCRAPVNQNEL 114 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVRCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 40 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 11 EVTCSICIEHFNDPRVLPCFHSFCRHCLE 39 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 35.5 bits (78), Expect = 0.070 Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCV 93 C +C L +P+ PC H+YC CV Sbjct: 18 CCICRDVLEEPLMAPCEHSYCSACV 42 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 35.1 bits (77), Expect = 0.093 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 35.1 bits (77), Expect = 0.093 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_50665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 35.1 bits (77), Expect = 0.093 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + K C +C L D Sbjct: 162 KKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLAD 214 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 35.1 bits (77), Expect = 0.093 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 35.1 bits (77), Expect = 0.093 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 17 EVTCSICIEHFDDPRVLPCLHSFCRHCLE 45 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 35.1 bits (77), Expect = 0.093 Identities = 12/43 (27%), Positives = 23/43 (53%) Query: 64 SSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALC 106 +++ C +C T D V + CGH +C C+ R ++ ++C Sbjct: 58 NANFECNICLDTARDAVISMCGHLFCWPCLHRWLETRPNRSMC 100 >SB_38753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 35.1 bits (77), Expect = 0.093 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + K C +C L D Sbjct: 70 KKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLAD 122 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 35.1 bits (77), Expect = 0.093 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + K C +C L D Sbjct: 310 KKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLAD 362 Score = 35.1 bits (77), Expect = 0.093 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + K C +C L D Sbjct: 636 KKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLAD 688 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 35.1 bits (77), Expect = 0.093 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + K C +C L D Sbjct: 168 KKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLAD 220 >SB_22842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 757 Score = 35.1 bits (77), Expect = 0.093 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + K C +C L D Sbjct: 313 KKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGEKHPACPICQETLAD 365 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 35.1 bits (77), Expect = 0.093 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 40 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 35.1 bits (77), Expect = 0.093 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++CR C+E Sbjct: 11 EVTCSICIEHFNDPRVLPCLHSFCRHCLE 39 >SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) Length = 474 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Query: 65 SDINCVLCCSTLVDPVTTPCGHTY-CRTCVERSMDYNIKCALC 106 +D+ C +C V+ PCGH Y C+TC ++ Y C LC Sbjct: 402 NDLTCQICMDAEVNTAFCPCGHVYCCQTCAS-NLYY---CPLC 440 >SB_37786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIK---CALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + K C +C L D Sbjct: 166 KKEEFHCAICLDVLEKPLSSKCQHSCCSDCWKSAFELGGKHPACPICQETLAD 218 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 34.7 bits (76), Expect = 0.12 Identities = 11/38 (28%), Positives = 22/38 (57%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALC 106 C +C T +P PC H++C+ C+++S+ + +C Sbjct: 17 CGICQETYNNPKVLPCLHSFCQNCLDKSIRSQERVLVC 54 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 8/52 (15%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMD------YNIKCALCLR--PLND 112 C C + +P PC HT+C C+ + N+ C CLR PL D Sbjct: 15 CPKCMNAYENPKVLPCLHTFCSQCLSEELHRDCEGRLNVTCPKCLRDFPLRD 66 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/83 (19%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Query: 27 VLLTQAIAVLIQNRNGRRLTRV-LFRAVRKEAASSWLKS--SDINCVLCCSTLVDPVTTP 83 V Q + L++ ++ L ++ + + +EA S ++ + +C++C + T Sbjct: 326 VTSVQELQSLMEKKDRELLKQMEVTKKAEEEARKSVVEEMEDEFSCIVCQELFIRATTLT 385 Query: 84 CGHTYCRTCVERSMDYNIKCALC 106 C H++C C++ + C +C Sbjct: 386 CSHSFCEYCLQSWLRKRNTCPIC 408 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 62 LKSSDINCVLCCSTLVDPVTTP-CGHTYCRTCVERSMDYNIKCALC 106 ++ +I+C +C +P+ P CGH+ C C++ N LC Sbjct: 16 VQREEISCPVCLEVFEEPLVLPSCGHSVCLQCLQNMTKRNPPSLLC 61 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Query: 54 RKEAASSWLKSSDINCVLCCSTLVDPVTTPCGHTYCRTCVE----RSMDYNIKCALC 106 R + ++ ++ C +C +P T C H CR C+E R I+C LC Sbjct: 6 RNRTTAMAVQLDELLCPICLDEFKEPKTLSCMHDLCRKCLEDMAARESSRVIRCPLC 62 >SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) Length = 406 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Query: 69 CVLCCSTLVDPVTTP-CGHTYCRTCVERSMDYN----IKCALC 106 C +C V+P + P C H CR C+E+ N ++C +C Sbjct: 22 CPVCIEVFVEPKSLPSCAHNVCRECLEKITKRNSIRFVECPIC 64 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Query: 64 SSDINCVLCCSTLVDPVTTPCGHTYCRTCVE---RSMDYNIKCALC 106 S +NC LC + P PC H++C C+E D C C Sbjct: 15 SKHLNCSLCHRLIRGPKLLPCLHSFCLACLEDLVTENDVGFNCPQC 60 >SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) Length = 96 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Query: 64 SSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLNDFDLSTTGGTI 122 S+ + C +C DP PC HT C C+E + N C P+++ +L G I Sbjct: 17 SNSLVCPICEEEYDDPKRLPCMHTICLGCLESMVPKNALIMKC--PIDEQELPMPMGGI 73 >SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 69 CVLCCSTLVDPVTT-PCGHTYCRTCVERSMDYNIKCALCLRPLND 112 C+ C L PV PCGH C C + + + +C C+ LN+ Sbjct: 431 CLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSSSARCPGCMDELNE 475 >SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) Length = 695 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/45 (31%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDY-NIKCALCLRPLND 112 C +C D PCGH C C+E+ + C C P+ D Sbjct: 185 CKICAENNKDVRIEPCGHLMCHLCLEQWQEKGGDGCPFCRSPIKD 229 >SB_12595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/52 (30%), Positives = 22/52 (42%) Query: 42 GRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPCGHTYCRTCV 93 G + R+ F V + + C C L D V T CGH YC +C+ Sbjct: 34 GTNILRIDFAMVGYKYTDKDTIEASHRCSKCGFILKDAVQTDCGHRYCLSCI 85 >SB_51713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/45 (31%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDY-NIKCALCLRPLND 112 C +C D PCGH C C+E+ + C C P+ D Sbjct: 381 CKICAENNKDVRIEPCGHLMCHLCLEQWQEKGGDGCPFCRSPMKD 425 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Query: 54 RKEAASSWLKSSDINCVLCCSTLVDPVTTP-CGHTYCRTCVE----RSMDYNIKCALC 106 + E S + + + +C +C ++P + P C H CR C+E S I+C +C Sbjct: 8 KAEKTLSGVINDECSCPVCLEDFLEPKSLPNCAHNVCRKCLEGMATDSESKEIRCPVC 65 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTC---VERSMDYNIKCALCL 107 +I C C DP PC H+ C+ C +E++ + I C +CL Sbjct: 18 EIWCRYCNGIFEDPRLLPCLHSLCKKCLKDIEQAQEGAIACPVCL 62 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 66 DINCVLCCSTLVDPVTT-PCGHTYCRTCVE 94 D C +C DPV T CGH +C +C+E Sbjct: 39 DYQCPICQLPFRDPVQTRDCGHRFCESCLE 68 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Query: 64 SSDINCVLCCSTLVDPVT-TPCGHTYCRTCVERSMDYN---IKCALC 106 + ++ C +C DP T T C H++C+ C+ + + I C LC Sbjct: 63 NDELRCSVCYEVFSDPRTLTACLHSFCKECLHKMLSKRSKYIHCPLC 109 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 33.1 bits (72), Expect = 0.37 Identities = 10/28 (35%), Positives = 15/28 (53%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCV 93 ++ C +C DP PC HT+C C+ Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECL 40 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 33.1 bits (72), Expect = 0.37 Identities = 10/28 (35%), Positives = 15/28 (53%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCV 93 ++ C +C DP PC HT+C C+ Sbjct: 13 EVECPICLERFKDPRVLPCLHTFCYECL 40 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 32.7 bits (71), Expect = 0.49 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCVE 94 ++ C +C DP PC H++C C+E Sbjct: 12 EVTCSICIEHFNDPRVLPCFHSFCLHCLE 40 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTCVERSMD-----YNIKCALC 106 I C C T+ PV PC + CR+C +++ + + C LC Sbjct: 25 ITCPSCKETMNGPVLLPCLDSICRSCCQKTAQKHGDTWTVPCRLC 69 >SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) Length = 818 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 65 SDINCVLCCSTLVDPVTTP-CGHTYCRTCVER-SMDYNIKCALC 106 S++ C +C + L D V P CG +YC C+ ++ +C C Sbjct: 55 SELRCPMCKNLLTDTVLIPCCGTSYCDECIRTYLLENEQECPTC 98 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTCVERSMD-----YNIKCALC 106 I C C T+ PV PC + CR+C +++ + + C LC Sbjct: 25 ITCPSCKETMNGPVLLPCLDSICRSCCQKTAQKHGDTWTVPCRLC 69 >SB_54922| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0028) Length = 116 Score = 32.7 bits (71), Expect = 0.49 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 65 SDINCVLCCSTLVDPVTTP-CGHTYCRTCVER-SMDYNIKCALC 106 S++ C +C + L D V P CG +YC C+ ++ +C C Sbjct: 55 SELRCPMCKNLLTDTVLIPCCGTSYCDECIRTYLLENEQECPTC 98 >SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) Length = 671 Score = 32.7 bits (71), Expect = 0.49 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Query: 36 LIQNRNGRRLTRVLFRAVRKEAASSWLKSS--DINCVLCCSTLVDPVTTPCGHTYCRTCV 93 ++ N++ R+ + +++K+A + L + +L + +PV P H +C C+ Sbjct: 68 VLANQHHLRVHKCRDVSLKKDAIKTMLNHQCPTKSAILDLEKVKEPVVCPNQHVFCSPCL 127 Query: 94 ERSMDYNIKCALCLRPLN 111 + + N C C P+N Sbjct: 128 DLWLRTNRYCPTCRTPIN 145 >SB_59028| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDY---NIKCALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + + C +C L D Sbjct: 112 KKEEFHCAICLDVLGKPLSSKCQHSCCSDCWKSAFELGETHPACPICHETLAD 164 >SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 67 INCVLCCSTLVDPV-TTPCGHTYCRTCVERSMDYNIKCALCL 107 ++C +C +VDP + C H CR C+ + N C CL Sbjct: 39 LSCRVCRGLVVDPFGSQSCLHYVCRGCLRKKRALNPGCRWCL 80 >SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) Length = 351 Score = 32.3 bits (70), Expect = 0.65 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 67 INCVLCCSTLVDPV-TTPCGHTYCRTCVERSMDYNIKCALCL 107 ++C +C +VDP + C H CR C+ + N C CL Sbjct: 39 LSCRVCRGLVVDPFGSQSCLHYVCRGCLRKKRALNPGCRWCL 80 >SB_32622| Best HMM Match : Ank (HMM E-Value=2.2e-05) Length = 509 Score = 32.3 bits (70), Expect = 0.65 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Query: 69 CVLCCSTL----VDPVTTPCGHTYCRTCVERSMDYNIK 102 C++C L V PV PCGH C C ER ++ I+ Sbjct: 206 CMICSDDLTGADVLPVALPCGHEACCLCWERYLNVKIR 243 >SB_29995| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-05) Length = 362 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 63 KSSDINCVLCCSTLVDPVTTPCGHTYCRTCVERSMDY---NIKCALCLRPLND 112 K + +C +C L P+++ C H+ C C + + + + C +C L D Sbjct: 112 KKEEFHCAICLDVLGKPLSSKCQHSCCSDCWKSAFELGETHPACPICHETLAD 164 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 31.9 bits (69), Expect = 0.86 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYN------IKCALCL 107 C LC L +P C H YC+ C++ + +KC CL Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETNEAGEKSKILKCPCCL 58 >SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 31.9 bits (69), Expect = 0.86 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTC---VERSMDYN--IKCALC 106 + C C + +P TPC H++C C + RS Y I C C Sbjct: 14 LTCRQCSNVFKNPRITPCLHSFCAECLNEIARSRPYQAYIACPTC 58 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 31.9 bits (69), Expect = 0.86 Identities = 11/26 (42%), Positives = 13/26 (50%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVE 94 C +C P PC HTYC CV+ Sbjct: 659 CPICSRPFKSPKILPCLHTYCSDCVK 684 >SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) Length = 230 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCV 93 +I C +C + D V P GH +CR+CV Sbjct: 16 NIICPICQFIIEDAVCCPQGHIFCRSCV 43 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 5/43 (11%) Query: 69 CVLCCSTLVDPVTTP-CGHTYCRTCVERSMDYN----IKCALC 106 C +C +P + P C H CR C+E+ N ++C +C Sbjct: 22 CPVCIEVFEEPKSLPSCAHNVCRECLEKITARNSSRFVECPIC 64 >SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) Length = 358 Score = 31.1 bits (67), Expect = 1.5 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 6/94 (6%) Query: 7 AAPHLAHIAASSESYARQARVLLTQAIAVLIQNRNGRRLTRVLFRAVR--KEAASSWLKS 64 A PH AA ESY ++ L +A I + LTR + + A S ++ Sbjct: 230 APPHATPQAAWEESYQQENYETLLN-LAEQIGEAKPKGLTRAEIDQLPTYRVTAESKKQN 288 Query: 65 SDINCVLCCSTLVDPV---TTPCGHTYCRTCVER 95 D CV+C + T PC H Y C+++ Sbjct: 289 DDARCVVCLVDFEEKQLVRTLPCLHEYHTRCIDK 322 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTC-----VERSMDYNIKCALCLRP 109 +NC C +P C HT+C+ C + + +I C LC +P Sbjct: 14 LNCRACHKVFTEPKILDCLHTFCQKCLGTHDILGAGTNSIVCPLCRKP 61 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 66 DINCVLCCSTLVDPVTTPCGHTYCRTCV-ERSMDY 99 + C LC T +P C HT+C C+ E+S ++ Sbjct: 95 EAECSLCHKTPSEPKILKCFHTFCNECLTEKSAEF 129 >SB_56038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTP 83 + NRNG TR+L +AV+ A S +DI+ ++CC+TL+ P Sbjct: 10 LPNRNGS--TRLLRKAVKNPKAPS----TDISELICCTTLLQGYPNP 50 >SB_17267| Best HMM Match : WSC (HMM E-Value=2e-12) Length = 255 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Query: 226 VLETGVRDGYDIA-RVQVITDLIPEDS 251 + +TGVR Y++ V VITD +PEDS Sbjct: 80 LFDTGVRRSYNLRDEVNVITDRVPEDS 106 >SB_37013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 6/48 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPC 84 + NR G TR+L +AV+ A+S +DI+ +CC+TL+ PC Sbjct: 10 LPNRYGS--TRLLRKAVKNPKAAS----TDISERICCTTLLQGYPNPC 51 >SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) Length = 765 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Query: 56 EAASSWLKSSDINCVLCCSTLVDPVTTPCGHT-YCRTCVERSMDYNIKCALCLRPLNDFD 114 E S +S+ C++C + V PC H C +C R KC LC + + + Sbjct: 675 ETPPSQQRSTHGTCIVCQNLPVTRALLPCRHACVCGSCFSR---LESKCPLCRQVIRSYF 731 Query: 115 LS 116 L+ Sbjct: 732 LT 733 >SB_26072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.5 bits (63), Expect = 4.6 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Query: 30 TQAIAVLIQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTP 83 T+ I ++ NR G TR+L +AV+ A S +DI+ +CC+TL+ P Sbjct: 30 TETIHTVLPNRYGS--TRLLRKAVKNPKAPS----TDISERICCTTLLQGYPNP 77 >SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) Length = 434 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 8/39 (20%) Query: 62 LKSSDINCVLC--CSTLVD-----PVTT-PCGHTYCRTC 92 L + D++ LC C TL+ PV PCGHT+C+ C Sbjct: 225 LDAEDMSTHLCPLCQTLMSGSRHTPVALIPCGHTFCQMC 263 >SB_6012| Best HMM Match : UBA (HMM E-Value=4.8e-05) Length = 140 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/58 (24%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 157 IPCPLFIFDPRYRLMVRRVLESETRKFGMV--ACERNGGGSEYGTILQVCDCIHMEDG 212 + CP F +DP ++ ++L+ T ++ + GG S G L C+ +G Sbjct: 78 VECPTFCYDPERSMLYSQILKLPTHLILVIDSVTQAGGGNSGGGLCLFCCEVASSSEG 135 >SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 158 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTCVERSMD-YNIKCALC 106 + C C + D + T C H +C C++ D KC C Sbjct: 104 LTCPCCNTRKKDAILTKCFHVFCYECLKTRYDTRQRKCPKC 144 >SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 406 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTCVERSMD-YNIKCALC 106 + C C + D + T C H +C C++ D KC C Sbjct: 352 LTCPCCNTRKKDAILTKCFHVFCYECLKTRYDTRQRKCPKC 392 >SB_12329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALC 106 + C +C ++ V PCGH C C + +M+ C +C Sbjct: 144 LRCKVCMDEQINAVLIPCGHMVC--CEQCAMNLE-ACPVC 180 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Query: 62 LKSSDINCVLCCSTLVDPVT-TPCGHTYCRTCVERSMDYNIKCALCLRP 109 L S C LC +P + CG+ +C C+ R + + C + P Sbjct: 1194 LPSHPAQCPLCAKVRTNPTALSTCGYVFCYPCIYRYLGQHGCCPVTHLP 1242 >SB_1522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPC 84 + NR G TR+L +AV+ A S +DI+ +CC+TL+ PC Sbjct: 37 LPNRYGS--TRLLRKAVKNPKAPS----TDISERICCTTLLQGYPNPC 78 >SB_58016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPC 84 + NR G TR+L +AV+ A S +DI+ +CC+TL+ PC Sbjct: 36 LPNRYGS--TRLLRKAVKNPKAPS----TDISERICCTTLLQGYPNPC 77 >SB_48253| Best HMM Match : zf-C3HC4 (HMM E-Value=0.12) Length = 156 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 4/29 (13%) Query: 79 PVTTP-CGHTYCRTCVERSMDYNIKCALC 106 PV P CGH+ C TC +R N KC C Sbjct: 40 PVVMPNCGHSCCSTCAKR---VNRKCPEC 65 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/49 (24%), Positives = 21/49 (42%) Query: 67 INCVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLNDFDL 115 + C C +P PC H +C C++++ C P D++L Sbjct: 16 LTCSACKGFYKNPKRLPCLHAFCCHCLKKTQRGTKLCERMRCPTCDYEL 64 >SB_25458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 6.1 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTP 83 I NR G TR+L +AV+ A +S+DI+ +CC+TL+ TP Sbjct: 37 IPNRYGS--TRLLRKAVKNPKA----QSTDISERICCTTLLQGYPTP 77 >SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) Length = 499 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/54 (24%), Positives = 20/54 (37%) Query: 69 CVLCCSTLVDPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLNDFDLSTTGGTI 122 C +C PV T C +C C+ + C+ C L D+ G + Sbjct: 332 CSICMGVPSTPVVTQCDQIFCSGCITAWLRNAGACSSCRSVLEVSDIDPLKGPL 385 >SB_5186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPC 84 + NR G TR+L +AV+ A S +DI+ +CC+TL+ PC Sbjct: 37 LPNRYGS--TRLLRKAVKNPKAPS----TDISERICCTTLLQGYPNPC 78 >SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) Length = 558 Score = 28.7 bits (61), Expect = 8.0 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Query: 59 SSWLKSSDINCVLCCSTLV---DPVTTPCGHTYCRTCVERSMDYNIKCALCLRPLNDFDL 115 +S + + CV+C D PC H + + CV+ + N C LC+ + + D Sbjct: 204 ASHVTEKNPKCVICLEGFKNGQDLRIVPCRHEFHKECVDPWLLSNFTCPLCMLNIVERDN 263 Query: 116 S 116 S Sbjct: 264 S 264 >SB_36807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPC 84 + NR G TR+L +AV+ A S +DI+ +CC+TL+ PC Sbjct: 10 LPNRYGS--TRLLRKAVKTPKAPS----TDISERICCTTLLQGYPNPC 51 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.7 bits (61), Expect = 8.0 Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 66 DINCVLCCSTLVDPVTTP-CGHTYCRTCVE 94 + C +C DP+ CGH +C++C++ Sbjct: 23 EYECPICQLAFRDPIQIEECGHRFCQSCLQ 52 >SB_8245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 8.0 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Query: 37 IQNRNGRRLTRVLFRAVRKEAASSWLKSSDINCVLCCSTLVDPVTTP 83 + NR+G TR+L +AV+ ASS +DI+ +CC+TL+ P Sbjct: 10 LPNRHGS--TRLLRKAVKNPKASS----TDISERICCTTLLQGYPNP 50 >SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) Length = 856 Score = 28.7 bits (61), Expect = 8.0 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Query: 79 PVTTPCGHTYCRTCV---ERSMDYNIKCALC 106 P+ CGHTYC +C+ R + C C Sbjct: 405 PLLLECGHTYCDSCIIKLSRLQKTQVACPEC 435 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 28.7 bits (61), Expect = 8.0 Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Query: 67 INCVLCCSTLVD----PVTTPCGHTYCRTCVER 95 + C +C D P++ CGHT C+ C+ + Sbjct: 12 LTCPICYHEFEDRQRGPISLACGHTICKACLSQ 44 >SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) Length = 610 Score = 28.7 bits (61), Expect = 8.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 51 RAVRKEAASSWLKSSDINCVLCCSTLVDPVTTPCGH 86 R K+ + +S D +C +C L+D V CGH Sbjct: 267 RNCEKQKVENVSESLDESCKVCMDNLIDCVLLECGH 302 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.326 0.137 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,448,543 Number of Sequences: 59808 Number of extensions: 434302 Number of successful extensions: 3387 Number of sequences better than 10.0: 134 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 39 Number of HSP's that attempted gapping in prelim test: 3256 Number of HSP's gapped (non-prelim): 164 length of query: 371 length of database: 16,821,457 effective HSP length: 83 effective length of query: 288 effective length of database: 11,857,393 effective search space: 3414929184 effective search space used: 3414929184 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -