Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000722-TA|BGIBMGA000722-PA|IPR002994|Surfeit locus 1
         (257 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein...    28   0.31 

>X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein
           Agm2 protein.
          Length = 599

 Score = 27.9 bits (59), Expect = 0.31
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 172 FMPKNNPEKGSWFYRDLDQMSAHIGCLPIWLDAK-GIP-DPPTGW 214
           F+P ++ ++  WF + + ++S +     +W D K G   DPP  W
Sbjct: 117 FVPNHSSDEHEWFKKSVQRVSGYEDYY-VWQDPKPGTERDPPNNW 160


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.321    0.139    0.445 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 277,285
Number of Sequences: 2123
Number of extensions: 11314
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 1
length of query: 257
length of database: 516,269
effective HSP length: 63
effective length of query: 194
effective length of database: 382,520
effective search space: 74208880
effective search space used: 74208880
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)