BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000720-TA|BGIBMGA000720-PA|undefined (156 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 27 0.097 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 2.8 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 6.4 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 26.6 bits (56), Expect = 0.097 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Query: 30 LHVYSRVLSPDGSGPRPIPECFSPTPLPSQPVHAAPSARTLAPRHQPTDPK 80 L+ + L D P P+P +P P P+Q + P+ + P T K Sbjct: 379 LNAINAALKSDEIPPEPVP---TPEPQPTQTTESEPTQASEQPTESSTTQK 426 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 2.8 Identities = 16/77 (20%), Positives = 30/77 (38%), Gaps = 3/77 (3%) Query: 54 TPLPSQPVHAAPSARTLAPRHQPTDPKSIGPPEIEGTEXXXXXXXXXXXXXSRVHPQSET 113 +P P + A+P+ + P+ P+SI + + S V P+ + Sbjct: 44 SPAPPEEEAASPTPGDVPT---PSSPRSISEDPLNCRDLPNSRCNSRESSDSLVQPRCPS 100 Query: 114 TPTSLTNRAITLLAIVT 130 + L+ RA L + T Sbjct: 101 GESMLSERAALLRGVPT 117 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.6 bits (41), Expect = 6.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Query: 40 DGSGPRPIPECFSPTPLPSQPVHAAPSARTLA 71 DG P+P + +P P + AP LA Sbjct: 65 DGWQVTPLPSDGTTSPEPDPEIPVAPEPAPLA 96 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.129 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,160 Number of Sequences: 317 Number of extensions: 1521 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 156 length of database: 114,650 effective HSP length: 52 effective length of query: 104 effective length of database: 98,166 effective search space: 10209264 effective search space used: 10209264 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -