BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000719-TA|BGIBMGA000719-PA|undefined (460 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0339 + 7452967-7453068,7453281-7453339,7453889-7454701,745... 30 3.4 03_06_0583 + 34901636-34901721,34901805-34901902,34902029-349021... 30 4.4 >09_02_0339 + 7452967-7453068,7453281-7453339,7453889-7454701, 7455123-7455498,7455978-7456019 Length = 463 Score = 30.3 bits (65), Expect = 3.4 Identities = 12/27 (44%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Query: 218 TPLTCIDTSLYGALLLVD-PEDEYFPE 243 +P T +DTS+ G L++VD PE+ ++P+ Sbjct: 77 SPTTTLDTSIAGELIMVDLPEELHYPQ 103 >03_06_0583 + 34901636-34901721,34901805-34901902,34902029-34902167, 34902262-34902290,34902406-34902502,34902593-34902648, 34902759-34902866,34902988-34903044,34905585-34905679, 34905822-34905998,34906086-34906189,34906595-34906664, 34906774-34906833 Length = 391 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 251 AVDAGLS-LIVFADWYNASLLRHVKFYDENTRQWWIPETGGS 291 AV G S ++VF + + L + YD R W+ PE GS Sbjct: 33 AVSIGKSKVVVFGGFADKRFLSDIAVYDVENRIWYTPECNGS 74 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,062,298 Number of Sequences: 37544 Number of extensions: 686711 Number of successful extensions: 1273 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1273 Number of HSP's gapped (non-prelim): 2 length of query: 460 length of database: 14,793,348 effective HSP length: 85 effective length of query: 375 effective length of database: 11,602,108 effective search space: 4350790500 effective search space used: 4350790500 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -