GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000719-TA|BGIBMGA000719-PA|undefined
         (460 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13 pro...    23   4.5  
DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.    22   7.9  

>DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13
           protein.
          Length = 377

 Score = 23.0 bits (47), Expect = 4.5
 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 287 ETGGSNVPALNDLLSMYQVALGD-RVFEGSFKLGGHPMY 324
           E GG ++PA++++L +  V   D       F     P+Y
Sbjct: 181 EVGGYDIPAMSNVLDIINVMTYDFHAMWAGFTAENSPLY 219


>DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.
          Length = 314

 Score = 22.2 bits (45), Expect = 7.9
 Identities = 7/9 (77%), Positives = 8/9 (88%)

Query: 162 LWDQFHSLR 170
           LWDQFH L+
Sbjct: 28  LWDQFHDLQ 36


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.138    0.441 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,813
Number of Sequences: 317
Number of extensions: 5338
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 2
length of query: 460
length of database: 114,650
effective HSP length: 59
effective length of query: 401
effective length of database: 95,947
effective search space: 38474747
effective search space used: 38474747
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)