GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000719-TA|BGIBMGA000719-PA|undefined
         (460 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ974167-1|ABJ52807.1|  434|Anopheles gambiae serpin 8 protein.        25   4.3  

>DQ974167-1|ABJ52807.1|  434|Anopheles gambiae serpin 8 protein.
          Length = 434

 Score = 25.0 bits (52), Expect = 4.3
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 244 EMATLKKAVDAGLSLIVF-ADW---YNASLLRHVKFYDEN 279
           EM+ L+ A    LS++ F   W   +N S   +V FYDEN
Sbjct: 201 EMSDLEDARLIMLSVLFFQGQWTIPFNRSFTTNVPFYDEN 240


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.320    0.138    0.441 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 529,263
Number of Sequences: 2123
Number of extensions: 23216
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 24
Number of HSP's gapped (non-prelim): 1
length of query: 460
length of database: 516,269
effective HSP length: 66
effective length of query: 394
effective length of database: 376,151
effective search space: 148203494
effective search space used: 148203494
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)