BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000719-TA|BGIBMGA000719-PA|undefined (460 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 4.1 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 5.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 5.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 5.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 5.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 5.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 5.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 5.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 5.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 5.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 5.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 5.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 5.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 5.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 5.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 5.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 5.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 5.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 5.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 5.4 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 5.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 5.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 7.1 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 9.4 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.4 bits (48), Expect = 4.1 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDSKIDLRSRTKEERLQHRREVW 43 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVW 43 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVW 43 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVW 43 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVW 43 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVW 43 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVW 43 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR +W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVW 43 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAW 43 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 7.1 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISSYSHHDEKFKQLRNEDNEIDLRSRTKEERLQHRREAW 43 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 9.4 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 124 NVTIESHDDTGDRTIKNATLTLPIRARVIPVPVRSRRLLW 163 N++ SH D + ++N + +R+R ++ RR W Sbjct: 4 NISNYSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREAW 43 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,066 Number of Sequences: 429 Number of extensions: 6333 Number of successful extensions: 30 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 24 length of query: 460 length of database: 140,377 effective HSP length: 60 effective length of query: 400 effective length of database: 114,637 effective search space: 45854800 effective search space used: 45854800 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -