BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000718-TA|BGIBMGA000718-PA|undefined (82 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 22 0.97 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 20 3.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 20 3.0 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 20 3.9 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.8 bits (44), Expect = 0.97 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 14 YVNEDLRLLCHIKDIDRAYQATLKVFKEYVPRVRT 48 Y N L+++ DI++ A ++ KE P ++T Sbjct: 64 YPNGTLQMIDEWGDIEKGNFAEVEALKEINPNLKT 98 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.2 bits (40), Expect = 3.0 Identities = 8/25 (32%), Positives = 11/25 (44%) Query: 44 PRVRTPSPINSSSEYEDNPLNYKMK 68 P + TP P + PLN +K Sbjct: 247 PAIVTPGPKQELPDLNHKPLNLTIK 271 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.2 bits (40), Expect = 3.0 Identities = 8/25 (32%), Positives = 11/25 (44%) Query: 44 PRVRTPSPINSSSEYEDNPLNYKMK 68 P + TP P + PLN +K Sbjct: 139 PAIVTPGPKQELPDLNHKPLNLTIK 163 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 19.8 bits (39), Expect = 3.9 Identities = 12/42 (28%), Positives = 17/42 (40%) Query: 30 RAYQATLKVFKEYVPRVRTPSPINSSSEYEDNPLNYKMKGNK 71 RAYQ + +K + P +S E LN KG + Sbjct: 358 RAYQVAVLEYKGTQTNYPSYEPTYDNSRREGKQLNPLNKGTE 399 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.133 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,588 Number of Sequences: 317 Number of extensions: 681 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 82 length of database: 114,650 effective HSP length: 46 effective length of query: 36 effective length of database: 100,068 effective search space: 3602448 effective search space used: 3602448 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.2 bits) S2: 36 (18.6 bits)
- SilkBase 1999-2023 -