BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000718-TA|BGIBMGA000718-PA|undefined (82 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 1.4 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 22 2.4 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 21 5.5 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 21 5.5 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 20 9.7 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.0 bits (47), Expect = 1.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Query: 63 LNYKMKGNKTIDLPLKKSKG 82 LNY++K ++ +P+K +KG Sbjct: 494 LNYELKRSERTSVPVKLAKG 513 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 14 YVNEDLRLLCHIKDIDRAYQAT 35 Y +DL LLC ++ I+ + T Sbjct: 40 YTEDDLTLLCRLRTINSELENT 61 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 29 DRAYQATLKVFKEYVPRVRTPSPINSSSEYEDNP 62 D Y TLK VP + P P+ ++ ++P Sbjct: 63 DTTYLDTLKCGDLMVPMRKKPIPLLCCPKFSNSP 96 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 21.0 bits (42), Expect = 5.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 15 VNEDLRLLCHIKDIDRAYQATLKVFKEYVPRVRTPS 50 +N L+ L + R Q L K ++P VR P+ Sbjct: 59 INSTLQTLILSEHNTRRSQLALGQLKPFLPAVRMPT 94 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 20.2 bits (40), Expect = 9.7 Identities = 8/23 (34%), Positives = 16/23 (69%) Query: 4 SELTLGVGLRYVNEDLRLLCHIK 26 ++L + V LR+V ++R LC ++ Sbjct: 224 AKLFVPVDLRHVKHEVRDLCMLR 246 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.133 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,747 Number of Sequences: 2123 Number of extensions: 2788 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 82 length of database: 516,269 effective HSP length: 53 effective length of query: 29 effective length of database: 403,750 effective search space: 11708750 effective search space used: 11708750 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -