BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000718-TA|BGIBMGA000718-PA|undefined (82 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC050336-1|AAH50336.1| 1553|Homo sapiens FRYL protein protein. 27 7.2 AK128543-1|BAC87492.1| 1433|Homo sapiens protein ( Homo sapiens ... 27 7.2 >BC050336-1|AAH50336.1| 1553|Homo sapiens FRYL protein protein. Length = 1553 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Query: 15 VNEDLRLLCHIKDID--RAYQATLKVFKEYVPRVRTPSPINSSSEYEDNPLNYKMKGNKT 72 VN + LL ++K + T+++ +E V ++ P++S + DNP Y++ + Sbjct: 1413 VNSEPSLLPYVKKVIVYLGRDKTMQLLEELVSELQLTDPVSSGVTHMDNPPYYRITSSYK 1472 Query: 73 I 73 I Sbjct: 1473 I 1473 >AK128543-1|BAC87492.1| 1433|Homo sapiens protein ( Homo sapiens cDNA FLJ46702 fis, clone TRACH3014183. ). Length = 1433 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Query: 15 VNEDLRLLCHIKDID--RAYQATLKVFKEYVPRVRTPSPINSSSEYEDNPLNYKMKGNKT 72 VN + LL ++K + T+++ +E V ++ P++S + DNP Y++ + Sbjct: 244 VNSEPSLLPYVKKVIVYLGRDKTMQLLEELVSELQLTDPVSSGVTHMDNPPYYRITSSYK 303 Query: 73 I 73 I Sbjct: 304 I 304 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.314 0.133 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,524,916 Number of Sequences: 224733 Number of extensions: 406729 Number of successful extensions: 658 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 658 Number of HSP's gapped (non-prelim): 2 length of query: 82 length of database: 73,234,838 effective HSP length: 60 effective length of query: 22 effective length of database: 59,750,858 effective search space: 1314518876 effective search space used: 1314518876 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -