BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000713-TA|BGIBMGA000713-PA|undefined (148 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 25 1.0 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 23 3.1 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 3.1 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 9.4 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 22 9.4 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 25.0 bits (52), Expect = 1.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 6/34 (17%) Query: 100 RAPAKMKPATHCCKLIQCEEEDI------PCCVP 127 R P K PATH L E I PCC P Sbjct: 65 RCPTKFNPATHHALLQSLLHEHIKYDVPKPCCAP 98 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 23.4 bits (48), Expect = 3.1 Identities = 10/53 (18%), Positives = 29/53 (54%) Query: 5 PYEEIGAIFNGNEIPDDICEALTNRTALNSELTYSKKEAHETLCNVCNVTPKD 57 P+++ + ++ DD+ + L + +++ T ++E +T ++C+ T +D Sbjct: 97 PFDDDSDFDDDSDFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNED 149 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.4 bits (48), Expect = 3.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 24 EALTNRTALNSELTYSKKE 42 + L RTAL+S +T SKKE Sbjct: 327 DLLQVRTALDSSITTSKKE 345 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 21.8 bits (44), Expect = 9.4 Identities = 8/27 (29%), Positives = 12/27 (44%) Query: 48 CNVCNVTPKDAPKGVQAQKVLHPDKDV 74 C VCN T G+ + P++ V Sbjct: 250 CRVCNYTEAQMAPGLTTASPVEPEEGV 276 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 21.8 bits (44), Expect = 9.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Query: 31 ALNSELTYSKKEAHETLCNVCNVTPKDAP 59 A ELTY HE L V N T + P Sbjct: 350 ANGGELTYDMVMGHEYLGQVVNETLRKYP 378 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.135 0.431 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,076 Number of Sequences: 2123 Number of extensions: 6336 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 5 length of query: 148 length of database: 516,269 effective HSP length: 59 effective length of query: 89 effective length of database: 391,012 effective search space: 34800068 effective search space used: 34800068 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -