BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000710-TA|BGIBMGA000710-PA|IPR000535|Major sperm protein, IPR008962|PapD-like (248 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 27 0.51 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.8 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 8.4 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 27.1 bits (57), Expect = 0.51 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Query: 140 EDKNKDDDHPVASINLKTTNTKSENVESDLQKATLEVIHLREEESK 185 E+ +D+D +A+ L T++ + + D Q LEVI L++++SK Sbjct: 497 EEDEEDEDDELAAGPLGTSDVVTVE-DGDGQYVVLEVIQLQDKDSK 541 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 83 EQLMDYKLKCVFETPRGTNLNDSGDNAAQNDVTKK 117 E LM+Y + C T + L D+ D A + + +K Sbjct: 1387 EPLMNYVISCWVRTSKALKLGDTVDIVAVDVLVEK 1421 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 146 DDHPVASINLKTTNTKSENVESDLQKATLEV 176 D H V S+N + EN E+ + +LEV Sbjct: 793 DQHEVDSLNDEIRRLNQENKEAFTSRMSLEV 823 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.128 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,230 Number of Sequences: 2123 Number of extensions: 8528 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 248 length of database: 516,269 effective HSP length: 62 effective length of query: 186 effective length of database: 384,643 effective search space: 71543598 effective search space used: 71543598 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -