BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000709-TA|BGIBMGA000709-PA|IPR002048|Calcium-binding EF-hand (155 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55990.1 68418.m06986 calcineurin B-like protein 2 (CBL2) ide... 77 5e-15 At5g24270.1 68418.m02855 calcineurin B-like protein, putative / ... 73 7e-14 At4g26570.1 68417.m03830 calcineurin B-like protein 3 (CBL3) ide... 73 9e-14 At4g16350.1 68417.m02477 calcineurin B-like protein 6 (CBL6) ide... 73 1e-13 At4g33000.2 68417.m04694 calcineurin B-like protein 10 (CBL10) i... 71 3e-13 At4g33000.1 68417.m04693 calcineurin B-like protein 10 (CBL10) i... 71 3e-13 At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3) ide... 71 3e-13 At4g26560.1 68417.m03828 calcineurin B-like protein, putative si... 69 1e-12 At4g17615.2 68417.m02635 calcineurin B-like protein 1 (CBL1) ide... 67 4e-12 At4g17615.1 68417.m02634 calcineurin B-like protein 1 (CBL1) ide... 67 4e-12 At1g64480.1 68414.m07310 calcineurin B-like protein 8 (CBL8) ide... 64 4e-11 At5g47100.1 68418.m05807 calcineurin B-like protein 9 (CBL9) ide... 62 2e-10 At4g01420.1 68417.m00182 calcineurin B-like protein 5 (CBL5) ide... 54 4e-08 At4g23650.1 68417.m03405 calcium-dependent protein kinase, putat... 49 2e-06 At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat... 49 2e-06 At1g76040.1 68414.m08830 calcium-dependent protein kinase, putat... 49 2e-06 At4g04700.1 68417.m00690 calcium-dependent protein kinase, putat... 48 3e-06 At4g04695.1 68417.m00689 calcium-dependent protein kinase, putat... 48 3e-06 At4g04720.1 68417.m00693 calcium-dependent protein kinase, putat... 47 5e-06 At4g04740.1 68417.m00695 calcium-dependent protein kinase, putat... 46 9e-06 At1g50700.1 68414.m05701 calcium-dependent protein kinase, putat... 46 9e-06 At5g19360.1 68418.m02307 calcium-dependent protein kinase, putat... 46 2e-05 At3g20410.1 68416.m02585 calmodulin-domain protein kinase isofor... 45 2e-05 At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat... 45 2e-05 At4g21940.1 68417.m03174 calcium-dependent protein kinase, putat... 45 3e-05 At5g12180.1 68418.m01429 calcium-dependent protein kinase, putat... 44 4e-05 At3g57530.1 68416.m06406 calcium-dependent protein kinase, putat... 44 4e-05 At1g66400.1 68414.m07541 calmodulin-related protein, putative si... 44 4e-05 At4g37010.1 68417.m05243 caltractin, putative / centrin, putativ... 44 5e-05 At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat... 44 5e-05 At5g04870.1 68418.m00510 calcium-dependent protein kinase isofor... 44 6e-05 At5g12480.1 68418.m01466 calmodulin-domain protein kinase isofor... 43 8e-05 At5g17470.1 68418.m02050 calmodulin-related protein, putative si... 42 1e-04 At4g03290.1 68417.m00449 calcium-binding protein, putative simil... 42 1e-04 At1g05990.1 68414.m00627 calcium-binding protein, putative stron... 42 1e-04 At2g17290.1 68415.m01997 calcium-dependent protein kinase isofor... 42 2e-04 At3g03400.1 68416.m00337 calmodulin-related protein, putative si... 42 2e-04 At2g36180.1 68415.m04440 calmodulin-related protein, putative si... 42 2e-04 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 41 3e-04 At4g32060.1 68417.m04563 calcium-binding EF hand family protein ... 41 3e-04 At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to ca... 41 3e-04 At3g10660.1 68416.m01282 calcium-dependent protein kinase isofor... 41 3e-04 At3g07490.1 68416.m00893 calcium-binding protein, putative simil... 41 3e-04 At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identica... 41 3e-04 At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost i... 41 3e-04 At2g31500.1 68415.m03848 calcium-dependent protein kinase, putat... 41 3e-04 At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identica... 41 3e-04 At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identica... 41 3e-04 At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identica... 41 3e-04 At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmod... 41 4e-04 At4g34070.1 68417.m04834 expressed protein 41 4e-04 At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to... 41 4e-04 At4g35310.1 68417.m05019 calcium-dependent protein kinase, putat... 40 6e-04 At3g03000.1 68416.m00295 calmodulin, putative similar to calmodu... 40 6e-04 At4g38230.1 68417.m05399 calcium-dependent protein kinase, putat... 40 8e-04 At4g36070.1 68417.m05135 calcium-dependent protein kinase family... 40 8e-04 At4g27790.1 68417.m03991 calcium-binding EF hand family protein ... 40 8e-04 At4g09570.1 68417.m01575 calcium-dependent protein kinase, putat... 40 8e-04 At3g59440.1 68416.m06630 calcium-binding protein, putative simil... 40 8e-04 At1g74740.1 68414.m08660 calcium-dependent protein kinase, putat... 40 8e-04 At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDP... 40 8e-04 At1g61950.1 68414.m06988 calcium-dependent protein kinase, putat... 40 0.001 At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CD... 39 0.001 At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CD... 39 0.001 At4g12860.1 68417.m02014 calcium-binding protein, putative simil... 39 0.002 At2g41860.2 68415.m05174 calcium-dependent protein kinase, putat... 39 0.002 At2g41860.1 68415.m05173 calcium-dependent protein kinase, putat... 39 0.002 At2g17890.1 68415.m02072 calcium-dependent protein kinase family... 39 0.002 At5g66210.2 68418.m08341 calcium-dependent protein kinase family... 38 0.002 At5g66210.1 68418.m08340 calcium-dependent protein kinase family... 38 0.002 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 38 0.002 At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calm... 38 0.002 At3g50360.1 68416.m05507 caltractin / centrin identical to caltr... 38 0.002 At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein... 38 0.002 At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calm... 38 0.002 At5g57190.1 68418.m07144 phosphatidylserine decarboxylase, putat... 38 0.004 At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-r... 38 0.004 At5g08580.1 68418.m01021 calcium-binding EF hand family protein ... 38 0.004 At5g44090.1 68418.m05394 calcium-binding EF hand family protein,... 37 0.005 At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDP... 37 0.005 At4g26470.1 68417.m03808 calcium-binding EF hand family protein ... 37 0.005 At3g51850.1 68416.m05686 calcium-dependent protein kinase, putat... 37 0.007 At3g03410.1 68416.m00339 calmodulin-related protein, putative si... 37 0.007 At1g76650.1 68414.m08919 calcium-binding EF hand family protein ... 36 0.009 At1g76640.1 68414.m08918 calmodulin-related protein, putative si... 36 0.009 At1g54450.1 68414.m06211 calcium-binding EF-hand family protein ... 36 0.009 At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to calmod... 36 0.012 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 36 0.016 At5g49480.1 68418.m06123 sodium-inducible calcium-binding protei... 36 0.016 At5g44460.1 68418.m05448 calcium-binding protein, putative simil... 36 0.016 At3g25600.1 68416.m03187 calmodulin, putative similar to calmodu... 36 0.016 At3g24110.1 68416.m03027 calcium-binding EF hand family protein ... 36 0.016 At1g32250.1 68414.m03967 calmodulin, putative similar to calmodu... 36 0.016 At1g73630.1 68414.m08524 calcium-binding protein, putative simil... 35 0.021 At4g25970.1 68417.m03737 phosphatidylserine decarboxylase, putat... 35 0.028 At5g42380.1 68418.m05160 calmodulin-related protein, putative si... 34 0.038 At3g22930.1 68416.m02889 calmodulin, putative strong similarity ... 34 0.038 At1g73440.1 68414.m08501 calmodulin-related low similarity to ca... 34 0.038 At5g28900.1 68418.m03562 calcium-binding EF hand family protein ... 34 0.050 At5g28850.2 68418.m03550 calcium-binding EF hand family protein ... 34 0.050 At5g28850.1 68418.m03549 calcium-binding EF hand family protein ... 34 0.050 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-r... 34 0.050 At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDP... 34 0.050 At1g18210.2 68414.m02267 calcium-binding protein, putative simil... 34 0.050 At1g18210.1 68414.m02266 calcium-binding protein, putative simil... 34 0.050 At1g03960.2 68414.m00382 calcium-binding EF hand family protein ... 34 0.050 At1g03960.1 68414.m00381 calcium-binding EF hand family protein ... 34 0.050 At3g10190.1 68416.m01220 calmodulin, putative similar to calmodu... 33 0.066 At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to calmod... 33 0.087 At2g15680.1 68415.m01795 calmodulin-related protein, putative si... 33 0.087 At3g47480.1 68416.m05163 calcium-binding EF hand family protein ... 33 0.11 At2g44310.1 68415.m05513 calcium-binding EF hand family protein ... 33 0.11 At1g24620.1 68414.m03097 polcalcin, putative / calcium-binding p... 32 0.15 At1g21550.1 68414.m02695 calcium-binding protein, putative conta... 32 0.15 At4g20780.1 68417.m03017 calcium-binding protein, putative simil... 32 0.20 At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding p... 31 0.35 At2g32450.1 68415.m03964 calcium-binding EF hand family protein ... 31 0.35 At5g39670.1 68418.m04804 calcium-binding EF hand family protein ... 31 0.46 At5g17480.1 68418.m02051 polcalcin, putative / calcium-binding p... 31 0.46 At3g25280.1 68416.m03157 proton-dependent oligopeptide transport... 31 0.46 At3g17470.1 68416.m02232 RelA/SpoT domain-containing protein / c... 31 0.46 At3g01830.1 68416.m00126 calmodulin-related protein, putative si... 31 0.46 At2g41410.1 68415.m05110 calmodulin, putative identical to SP|P3... 31 0.46 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-r... 31 0.46 At3g29000.1 68416.m03624 calcium-binding EF hand family protein ... 30 0.61 At3g18430.1 68416.m02343 calcium-binding EF hand family protein ... 30 0.61 At1g05150.1 68414.m00518 calcium-binding EF hand family protein ... 30 0.61 At3g44040.1 68416.m04716 expressed protein 29 1.4 At4g18160.1 68417.m02698 outward rectifying potassium channel, p... 29 1.9 At4g13750.1 68417.m02134 expressed protein 29 1.9 At1g64060.1 68414.m07256 respiratory burst oxidase protein F (Rb... 29 1.9 At5g03110.1 68418.m00259 expressed protein various predicted pro... 28 2.5 At4g25090.1 68417.m03604 respiratory burst oxidase, putative / N... 28 2.5 At5g51060.1 68418.m06329 respiratory burst oxidase protein C (Rb... 28 3.3 At3g63150.1 68416.m07092 GTP-binding protein-related low similar... 28 3.3 At1g12310.1 68414.m01423 calmodulin, putative similar to calmodu... 28 3.3 At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) ne... 27 4.3 At5g60010.1 68418.m07525 ferric reductase-like transmembrane com... 27 4.3 At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative... 27 4.3 At3g01830.2 68416.m00127 calmodulin-related protein, putative si... 27 4.3 At1g62820.1 68414.m07092 calmodulin, putative similar to calmodu... 27 4.3 At1g18530.1 68414.m02312 calmodulin, putative similar to calmodu... 27 4.3 At1g09090.2 68414.m01015 respiratory burst oxidase protein B (Rb... 27 4.3 At1g09090.1 68414.m01014 respiratory burst oxidase protein B (Rb... 27 4.3 At5g58440.1 68418.m07319 phox (PX) domain-containing protein sim... 27 5.7 At4g28220.1 68417.m04044 NADH dehydrogenase-related similar to 6... 27 5.7 At2g30130.1 68415.m03667 LOB domain protein 12 / lateral organ b... 27 5.7 At4g03560.1 68417.m00488 two-pore calcium channel (TPC1) identic... 27 7.5 At3g45810.1 68416.m04958 ferric reductase-like transmembrane com... 27 7.5 At3g27650.1 68416.m03453 LOB domain protein 25 / lateral organ b... 27 7.5 At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related... 27 7.5 At1g31320.1 68414.m03832 LOB domain protein 4 / lateral organ bo... 27 7.5 At1g09720.1 68414.m01091 kinase interacting family protein simil... 27 7.5 At5g58410.1 68418.m07314 expressed protein contains similarity t... 26 10.0 At5g10500.1 68418.m01216 kinase interacting family protein simil... 26 10.0 At2g45670.1 68415.m05678 calcineurin B subunit-related contains ... 26 10.0 At2g34030.1 68415.m04166 calcium-binding EF hand family protein ... 26 10.0 At1g59620.1 68414.m06705 disease resistance protein (CC-NBS clas... 26 10.0 At1g53210.1 68414.m06031 sodium/calcium exchanger family protein... 26 10.0 At1g20060.1 68414.m02511 kinesin motor protein-related 26 10.0 At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 26 10.0 At1g03470.1 68414.m00328 kinase interacting family protein simil... 26 10.0 >At5g55990.1 68418.m06986 calcineurin B-like protein 2 (CBL2) identical to calcineurin B-like protein 2 GI:3309084 from [Arabidopsis thaliana] Length = 226 Score = 77.0 bits (181), Expect = 5e-15 Identities = 42/124 (33%), Positives = 70/124 (56%), Gaps = 4/124 (3%) Query: 30 SKFASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 S FA VF +FD ++G + FEEF RALSV +D+K+H++F+LYD+ G+I R E Sbjct: 84 SLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQE 143 Query: 89 MYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQ 148 + +V A G + + + +DK F++ D HD ++ EE+R P +++ Sbjct: 144 VKQMVVATLAESGMNLK---DTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLK 200 Query: 149 ALSL 152 ++L Sbjct: 201 NMTL 204 >At5g24270.1 68418.m02855 calcineurin B-like protein, putative / calcium sensor homolog (SOS3) identical to calcium sensor homolog [Arabidopsis thaliana] GI:3309575; similar to calcineurin B-like protein 8 (GI:15866276) [Arabidopsis thaliana] Length = 222 Score = 73.3 bits (172), Expect = 7e-14 Identities = 39/122 (31%), Positives = 73/122 (59%), Gaps = 4/122 (3%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 FA +F VFD +G IEF EF+R+L V + EK+ +AF+LYD+ G+I R+E+ Sbjct: 75 FADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFIEREELK 134 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 +V A ++ ++ E+ + VDK F Q D+ +D ++ ++E+++ +P +++ + Sbjct: 135 EMVVA---LLHESELVLSEDMIEVMVDKAFVQADRKNDGKIDIDEWKDFVSLNPSLIKNM 191 Query: 151 SL 152 +L Sbjct: 192 TL 193 >At4g26570.1 68417.m03830 calcineurin B-like protein 3 (CBL3) identical to calcineurin B-like protein 3 (GI:22136404) [Arabidopsis thaliana] Length = 226 Score = 72.9 bits (171), Expect = 9e-14 Identities = 42/124 (33%), Positives = 68/124 (54%), Gaps = 4/124 (3%) Query: 30 SKFASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 S FA VF +FD ++G + FEEF RALSV +++K+ ++F+LYD+ G+I R E Sbjct: 84 SLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQE 143 Query: 89 MYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQ 148 + +V A G E + +DK F++ D HD R+ EE+R P +++ Sbjct: 144 VKQMVVATLAESGMNLSDE---IIESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLK 200 Query: 149 ALSL 152 ++L Sbjct: 201 NMTL 204 >At4g16350.1 68417.m02477 calcineurin B-like protein 6 (CBL6) identical to calcineurin B-like protein 6 (GI:11065943) [Arabidopsis thaliana] Length = 226 Score = 72.5 bits (170), Expect = 1e-13 Identities = 39/124 (31%), Positives = 69/124 (55%), Gaps = 4/124 (3%) Query: 30 SKFASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 S FA VF +FD N G ++FE F R+LSV ++K+ ++F+LYD++ GYI R E Sbjct: 78 SLFADRVFDLFDTKNTGILDFEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQE 137 Query: 89 MYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQ 148 + +V + + ++ ++ + +DK F++ D D ++ EE+R P ++Q Sbjct: 138 VKQMV---VRTLAESGMNLSDHVIESIIDKTFEEADTKLDGKIDKEEWRSLVLRHPSLLQ 194 Query: 149 ALSL 152 +SL Sbjct: 195 NMSL 198 >At4g33000.2 68417.m04694 calcineurin B-like protein 10 (CBL10) identical to calcineurin B-like protein 10 [Arabidopsis thaliana] GI:29150248 Length = 246 Score = 71.3 bits (167), Expect = 3e-13 Identities = 45/129 (34%), Positives = 71/129 (55%), Gaps = 5/129 (3%) Query: 25 PQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGY 83 P G+ + F VF +FDE +G IEFEEFI ALSV ++ EK +AFRLYD+ G+ Sbjct: 101 PYGE-NLFLDRVFDLFDEKKNGVIEFEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGF 159 Query: 84 ITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKAD 143 I R+E+ +V AI ++ DE +DK F D + D +++ +E+ Sbjct: 160 IEREEVQQMVSAI--LLESDMMLSDELLTM-IIDKTFADADSDKDGKISKDEWNVYVHKH 216 Query: 144 PRIVQALSL 152 P +++ ++L Sbjct: 217 PSLLKNMTL 225 Score = 31.1 bits (67), Expect = 0.35 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 8/84 (9%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEE---FIRALSVTSRGNLDEKL 69 F+ FI F P + FR++D G IE EE + A+ + S L ++L Sbjct: 125 FEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIEREEVQQMVSAILLESDMMLSDEL 184 Query: 70 -----HWAFRLYDVDNDGYITRDE 88 F D D DG I++DE Sbjct: 185 LTMIIDKTFADADSDKDGKISKDE 208 >At4g33000.1 68417.m04693 calcineurin B-like protein 10 (CBL10) identical to calcineurin B-like protein 10 [Arabidopsis thaliana] GI:29150248 Length = 256 Score = 71.3 bits (167), Expect = 3e-13 Identities = 45/129 (34%), Positives = 71/129 (55%), Gaps = 5/129 (3%) Query: 25 PQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGY 83 P G+ + F VF +FDE +G IEFEEFI ALSV ++ EK +AFRLYD+ G+ Sbjct: 111 PYGE-NLFLDRVFDLFDEKKNGVIEFEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGF 169 Query: 84 ITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKAD 143 I R+E+ +V AI ++ DE +DK F D + D +++ +E+ Sbjct: 170 IEREEVQQMVSAI--LLESDMMLSDELLTM-IIDKTFADADSDKDGKISKDEWNVYVHKH 226 Query: 144 PRIVQALSL 152 P +++ ++L Sbjct: 227 PSLLKNMTL 235 Score = 31.1 bits (67), Expect = 0.35 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 8/84 (9%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEE---FIRALSVTSRGNLDEKL 69 F+ FI F P + FR++D G IE EE + A+ + S L ++L Sbjct: 135 FEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIEREEVQQMVSAILLESDMMLSDEL 194 Query: 70 -----HWAFRLYDVDNDGYITRDE 88 F D D DG I++DE Sbjct: 195 LTMIIDKTFADADSDKDGKISKDE 218 >At4g26570.2 68417.m03831 calcineurin B-like protein 3 (CBL3) identical to calcineurin B-like protein 3 (GI:22136404) [Arabidopsis thaliana] Length = 230 Score = 71.3 bits (167), Expect = 3e-13 Identities = 40/123 (32%), Positives = 68/123 (55%), Gaps = 4/123 (3%) Query: 31 KFASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 ++ S VF +FD ++G + FEEF RALSV +++K+ ++F+LYD+ G+I R E+ Sbjct: 89 RYQSQVFDLFDTKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEV 148 Query: 90 YNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQA 149 +V A G E + +DK F++ D HD R+ EE+R P +++ Sbjct: 149 KQMVVATLAESGMNLSDE---IIESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLKN 205 Query: 150 LSL 152 ++L Sbjct: 206 MTL 208 >At4g26560.1 68417.m03828 calcineurin B-like protein, putative similar to calcineurin B-like protein 3 [Arabidopsis thaliana] GI:3309086, calcineurin B-like protein 2 [Arabidopsis thaliana] GI:3309084; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 214 Score = 68.9 bits (161), Expect = 1e-12 Identities = 40/124 (32%), Positives = 67/124 (54%), Gaps = 4/124 (3%) Query: 30 SKFASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 S F+ VF +FD N+DG + FEEF RALSV +D+K+ +F+LYD+ G+I R Sbjct: 72 SLFSERVFDLFDTNHDGLLGFEEFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQG 131 Query: 89 MYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQ 148 + +V A G + + + + +DK F Q D H+ + EE+ + P +++ Sbjct: 132 VKQLVVATLAASGMS---QSDEIVESIIDKTFVQADTKHEGMIDEEEWMDLVFRHPLLLK 188 Query: 149 ALSL 152 ++L Sbjct: 189 NMTL 192 >At4g17615.2 68417.m02635 calcineurin B-like protein 1 (CBL1) identical to calcineurin B-like protein 1 (GI:3309082) [Arabidopsis thaliana] Length = 171 Score = 67.3 bits (157), Expect = 4e-12 Identities = 36/122 (29%), Positives = 71/122 (58%), Gaps = 4/122 (3%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSVTS-RGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 FA+ +F +FD G I+F +F+R+L+V +L++K+ + FRLYD+D GYI R E+ Sbjct: 29 FANRIFDMFDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDCTGYIERQEVK 88 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 ++ A ++ ++ + T + +DK F+ D N D ++ E+ + +P +++ + Sbjct: 89 QMLIA---LLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIM 145 Query: 151 SL 152 +L Sbjct: 146 TL 147 >At4g17615.1 68417.m02634 calcineurin B-like protein 1 (CBL1) identical to calcineurin B-like protein 1 (GI:3309082) [Arabidopsis thaliana] Length = 213 Score = 67.3 bits (157), Expect = 4e-12 Identities = 36/122 (29%), Positives = 71/122 (58%), Gaps = 4/122 (3%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSVTS-RGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 FA+ +F +FD G I+F +F+R+L+V +L++K+ + FRLYD+D GYI R E+ Sbjct: 71 FANRIFDMFDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDCTGYIERQEVK 130 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 ++ A ++ ++ + T + +DK F+ D N D ++ E+ + +P +++ + Sbjct: 131 QMLIA---LLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIM 187 Query: 151 SL 152 +L Sbjct: 188 TL 189 >At1g64480.1 68414.m07310 calcineurin B-like protein 8 (CBL8) identical to calcineurin B-like protein 8 (GI:15866276) [Arabidopsis thaliana]; similar to CALCINEURIN B SUBUNIT GB:P25296 from [Saccharomyces cerevisiae] Length = 214 Score = 64.1 bits (149), Expect = 4e-11 Identities = 38/122 (31%), Positives = 69/122 (56%), Gaps = 4/122 (3%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLD-EKLHWAFRLYDVDNDGYITRDEMY 90 FA VF +FD +G IEF EF+R+LS+ + EK + F+L+D+ G+I E+ Sbjct: 75 FADRVFYMFDRKRNGVIEFGEFVRSLSIFHPYTPEHEKSAFMFKLFDLHGTGFIEPHELK 134 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 +V A ++G+T E + + V++ ++D N D ++ EE++E +P I++ + Sbjct: 135 KMVGA---LLGETDLELSEESIEAIVEQTMLEVDTNKDGKIDEEEWKELVAKNPSILKNM 191 Query: 151 SL 152 +L Sbjct: 192 TL 193 >At5g47100.1 68418.m05807 calcineurin B-like protein 9 (CBL9) identical to calcineurin B-like protein 9 (GI:5866279) and calcium-binding protein AtCBL9 (GI:16151825) [Arabidopsis thaliana]; similar to calcineurin B-like protein 1 (GI:3309082) [Arabidopsis thaliana] Length = 213 Score = 62.1 bits (144), Expect = 2e-10 Identities = 34/122 (27%), Positives = 70/122 (57%), Gaps = 4/122 (3%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSVTS-RGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 FA+ +F +FD G I+F +F+R+L+V +L+EK + FRLYD+D G+I R E+ Sbjct: 71 FANRIFDLFDVKRKGVIDFGDFVRSLNVFHPNASLEEKTDFTFRLYDMDCTGFIERQEVK 130 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 ++ A ++ ++ ++T + +D+ F+ D + D ++ E+ +P +++ + Sbjct: 131 QMLIA---LLCESEMKLADDTIEMILDQTFEDADVDRDGKIDKTEWSNFVIKNPSLLKIM 187 Query: 151 SL 152 +L Sbjct: 188 TL 189 Score = 30.3 bits (65), Expect = 0.61 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 8/89 (8%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEE---FIRALSVTSRGNLDEK- 68 F F++ F P + FR++D + G IE +E + AL S L + Sbjct: 89 FGDFVRSLNVFHPNASLEEKTDFTFRLYDMDCTGFIERQEVKQMLIALLCESEMKLADDT 148 Query: 69 ----LHWAFRLYDVDNDGYITRDEMYNIV 93 L F DVD DG I + E N V Sbjct: 149 IEMILDQTFEDADVDRDGKIDKTEWSNFV 177 >At4g01420.1 68417.m00182 calcineurin B-like protein 5 (CBL5) identical to calcineurin B-like protein 5 (GI:9965366) [Arabidopsis thaliana]; similar to N. crassa calcineurin calcium-regulated protein phosphatase, GenBank accession number P87072 Length = 203 Score = 54.0 bits (124), Expect = 4e-08 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 4/105 (3%) Query: 33 ASLVFRVFDENNDGSIEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDEMYN 91 A +F +FD NDG+I+F EF+ L++ + +K +AFRLYD G+I +E Sbjct: 71 AERIFGLFDMRNDGAIDFGEFVHTLNIFHPNSSPRDKAIFAFRLYDTRETGFIEPEE--- 127 Query: 92 IVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 + + I ++ ++ E+ V K F++ D D + LEE+ Sbjct: 128 VKEMIIDVLEESELMLSESIIDSIVSKTFEEADWKKDGIIDLEEW 172 Score = 29.5 bits (63), Expect = 1.1 Identities = 26/89 (29%), Positives = 33/89 (37%), Gaps = 8/89 (8%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEE----FIRALS----VTSRGN 64 F F+ F P P A FR++D G IE EE I L + S Sbjct: 88 FGEFVHTLNIFHPNSSPRDKAIFAFRLYDTRETGFIEPEEVKEMIIDVLEESELMLSESI 147 Query: 65 LDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 +D + F D DG I +E N V Sbjct: 148 IDSIVSKTFEEADWKKDGIIDLEEWENFV 176 >At4g23650.1 68417.m03405 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 529 Score = 48.8 bits (111), Expect = 2e-06 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 13/108 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + DGSI++ EFI A +R ++ L+ AF+ +D DN GYIT +E+ + Y M Sbjct: 428 DMDGDGSIDYLEFISATMHMNRIEREDHLYTAFQFFDNDNSGYITMEEL-ELAMKKYNM- 485 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF-REGSKADPRIV 147 K + +I ++D + D ++ EEF K +P +V Sbjct: 486 ----------GDDKSIKEIIAEVDTDRDGKINYEEFVAMMKKGNPELV 523 Score = 30.3 bits (65), Expect = 0.61 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 F+ FD +N G I EE A+ + G+ D+ + D D DG I +E Sbjct: 460 FQFFDNDNSGYITMEELELAMKKYNMGD-DKSIKEIIAEVDTDRDGKINYEE 510 >At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 534 Score = 48.8 bits (111), Expect = 2e-06 Identities = 34/113 (30%), Positives = 62/113 (54%), Gaps = 17/113 (15%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + G+I++ EF+ A R +E L AF+ +D D G+ITRDE+ + + Y M Sbjct: 434 DVDKSGTIDYIEFVTATMHRHRLEKEENLIEAFKYFDKDRSGFITRDELKHSMTE-YGM- 491 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF----REG-SKADPRIVQ 148 D+ T +D++ + +D ++D R+ EEF R+G + +DP++++ Sbjct: 492 ------GDDAT----IDEVINDVDTDNDGRINYEEFVAMMRKGTTDSDPKLIR 534 >At1g76040.1 68414.m08830 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 323 Score = 48.8 bits (111), Expect = 2e-06 Identities = 34/113 (30%), Positives = 62/113 (54%), Gaps = 17/113 (15%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + G+I++ EF+ A R +E L AF+ +D D G+ITRDE+ + + Y M Sbjct: 223 DVDKSGTIDYIEFVTATMHRHRLEKEENLIEAFKYFDKDRSGFITRDELKHSMTE-YGM- 280 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF----REG-SKADPRIVQ 148 D+ T +D++ + +D ++D R+ EEF R+G + +DP++++ Sbjct: 281 ------GDDAT----IDEVINDVDTDNDGRINYEEFVAMMRKGTTDSDPKLIR 323 >At4g04700.1 68417.m00690 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069 Length = 485 Score = 48.0 bits (109), Expect = 3e-06 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +G+I+ +EFI A + + DE ++ AF+ +D DNDG+IT++E+ Sbjct: 381 DMDGNGTIDIDEFISATMHRYKLDRDEHVYKAFQHFDKDNDGHITKEEL----------- 429 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 + ED + + +I D ++D ++ EEFR Sbjct: 430 -EMAMKEDGAGDEGSIKQIIADADTDNDGKINFEEFR 465 Score = 30.7 bits (66), Expect = 0.46 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 F+ FD++NDG I EE A+ G+ + + D DNDG I +E Sbjct: 413 FQHFDKDNDGHITKEELEMAMKEDGAGD-EGSIKQIIADADTDNDGKINFEE 463 >At4g04695.1 68417.m00689 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 484 Score = 48.0 bits (109), Expect = 3e-06 Identities = 29/97 (29%), Positives = 55/97 (56%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +G+I+ +EFI A R + D+ ++ AF+ +D DNDG+IT++E+ +M Sbjct: 381 DVDGNGTIDIDEFISATMHRYRLDRDDHVYQAFQHFDKDNDGHITKEEL--------EMA 432 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 + DE + + +I ++D ++D ++ EEFR Sbjct: 433 MKEHGVGDEVS----IKQIITEVDTDNDGKINFEEFR 465 Score = 32.7 bits (71), Expect = 0.11 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 6/78 (7%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F+ FD++NDG I EE A+ G+ + + D DNDG I +E ++ + Sbjct: 413 FQHFDKDNDGHITKEELEMAMKEHGVGD-EVSIKQIITEVDTDNDGKINFEEFRTMMRS- 470 Query: 97 YQMVGQTPQPEDENTPQK 114 G + QP+ E P K Sbjct: 471 ----GSSLQPQRELLPIK 484 >At4g04720.1 68417.m00693 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase(CDPK) [Carrot] SWISS-PROT:P28582 Length = 531 Score = 47.2 bits (107), Expect = 5e-06 Identities = 30/96 (31%), Positives = 54/96 (56%), Gaps = 12/96 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +G+I++ EFI A + + DE ++ AF+ +D DN G+ITRDE+ + + Y M Sbjct: 429 DVDGNGTIDYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSGHITRDELESAMKE-YGM- 486 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 DE + + ++ ++D ++D R+ EEF Sbjct: 487 ------GDEAS----IKEVISEVDTDNDGRINFEEF 512 >At4g04740.1 68417.m00695 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494 Length = 520 Score = 46.4 bits (105), Expect = 9e-06 Identities = 30/97 (30%), Positives = 54/97 (55%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +G+I++ EFI A + + DE +H AF+ D D +G+ITRDE+ + + Y M Sbjct: 418 DVDGNGTIDYYEFISATMHRYKLHHDEHVHKAFQHLDKDKNGHITRDELESAMKE-YGM- 475 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 DE + + ++ ++D ++D ++ EEFR Sbjct: 476 ------GDEAS----IKEVISEVDTDNDGKINFEEFR 502 >At1g50700.1 68414.m05701 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 521 Score = 46.4 bits (105), Expect = 9e-06 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 16/110 (14%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +GSI++ EFI A R +E ++ AF+ +D D GYIT DE+ +A + Sbjct: 423 DVDGNGSIDYIEFITATMHRHRLESNENVYKAFQHFDKDGSGYITTDEL----EAALKEY 478 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF----REGSKADPRI 146 G D+ T + +I +D ++D R+ +EF R G+ PR+ Sbjct: 479 GM----GDDAT----IKEILSDVDADNDGRINYDEFCAMMRSGNPQQPRL 520 >At5g19360.1 68418.m02307 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748 Length = 523 Score = 45.6 bits (103), Expect = 2e-05 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 12/96 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +G+I++ EFI A +R + +E L+ AF+ +D DN GYIT +E+ + Sbjct: 418 DADGNGTIDYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITTEELEQALREFGMND 477 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 G + + +I ++D ++D R+ EEF Sbjct: 478 G------------RDIKEIISEVDGDNDGRINYEEF 501 >At3g20410.1 68416.m02585 calmodulin-domain protein kinase isoform 9 (CPK9) identical to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 541 Score = 45.2 bits (102), Expect = 2e-05 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 12/96 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +GSI++ EFI A R +E L+ AF+ +D D+ GYIT DE+ + + Y M Sbjct: 441 DVDGNGSIDYIEFITATMHRHRLESNENLYKAFQHFDKDSSGYITIDELESALKE-YGM- 498 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 D+ T + ++ +D ++D R+ EEF Sbjct: 499 ------GDDAT----IKEVLSDVDSDNDGRINYEEF 524 >At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 583 Score = 45.2 bits (102), Expect = 2e-05 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 13/96 (13%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D +N G+I++ EFI A+ ++ ++ L AF +D D GYITRDE+ A Q Sbjct: 484 DIDNSGTIDYGEFIAAMVHLNKIEKEDHLFTAFSYFDQDGSGYITRDELQ---QACKQF- 539 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 +D I ++DK++D R+ EF Sbjct: 540 ---------GLADVHLDDILREVDKDNDGRIDYSEF 566 Score = 29.9 bits (64), Expect = 0.81 Identities = 15/53 (28%), Positives = 24/53 (45%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F++ D +N G I EE + L D ++ + D+DN G I E Sbjct: 443 MFKMIDTDNSGHITLEELKKGLDRVGADLKDSEILGLMQAADIDNSGTIDYGE 495 Score = 28.7 bits (61), Expect = 1.9 Identities = 11/34 (32%), Positives = 20/34 (58%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKL 69 + R D++NDG I++ EF+ + T G + K+ Sbjct: 549 ILREVDKDNDGRIDYSEFVDMMQDTGFGKMGLKV 582 >At4g21940.1 68417.m03174 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423 Length = 554 Score = 44.8 bits (101), Expect = 3e-05 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 12/96 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +G+I++ EFI A R + DE + AF+ +D DN G+IT DE+ + + Y M Sbjct: 451 DVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSGFITMDELESAMKE-YGM- 508 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 DE + + ++ ++D ++D R+ EEF Sbjct: 509 ------GDEAS----IKEVIAEVDTDNDGRINYEEF 534 Score = 29.9 bits (64), Expect = 0.81 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 F+ FD++N G I +E A+ G+ + + D DNDG I +E Sbjct: 483 FQYFDKDNSGFITMDELESAMKEYGMGD-EASIKEVIAEVDTDNDGRINYEE 533 >At5g12180.1 68418.m01429 calcium-dependent protein kinase, putative / CDPK, putative Length = 528 Score = 44.4 bits (100), Expect = 4e-05 Identities = 20/49 (40%), Positives = 33/49 (67%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 D + +G+I++ EFI A +R + +E L+ AF+ +D DN GYIT +E+ Sbjct: 423 DADGNGTIDYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEEL 471 Score = 28.3 bits (60), Expect = 2.5 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 F+ FD++N G I EE +AL N + D DNDG I DE Sbjct: 455 FQHFDKDNSGYITMEELEQALREFGM-NDGRDIKEIISEVDGDNDGRINYDE 505 >At3g57530.1 68416.m06406 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 538 Score = 44.4 bits (100), Expect = 4e-05 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 16/122 (13%) Query: 17 IKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSR--GNLDEKLHWAFR 74 +KI Q P ++ D + DG ++ +EFI A+SV R GN DE L AF Sbjct: 389 LKIGLQKLGHAIPQDDLQILMDAGDIDRDGYLDCDEFI-AISVHLRKMGN-DEHLKKAFA 446 Query: 75 LYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLE 134 +D +N+GYI E+ + +A+ +G T ++ VD I +D + D R++ E Sbjct: 447 FFDQNNNGYI---EIEELREALSDELG---------TSEEVVDAIIRDVDTDKDGRISYE 494 Query: 135 EF 136 EF Sbjct: 495 EF 496 Score = 31.5 bits (68), Expect = 0.26 Identities = 26/102 (25%), Positives = 42/102 (41%), Gaps = 11/102 (10%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F++ D + G I +E L + L D+D DGY+ DE I + Sbjct: 373 FQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDAGDIDRDGYLDCDEFIAISVHL 432 Query: 97 YQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 +M DE+ + K F D+N++ + +EE RE Sbjct: 433 RKM------GNDEH-----LKKAFAFFDQNNNGYIEIEELRE 463 >At1g66400.1 68414.m07541 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced from SP:P25070 [Arabidopsis thaliana]; contains Pfam profile: PF00036 EF hand (4 copies) Length = 157 Score = 44.4 bits (100), Expect = 4e-05 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 8/106 (7%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 VF+ FD+NNDG I +E + S E+ + +D+D +G+I DE A Sbjct: 19 VFQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFDLDGNGFIDLDEFV----A 74 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSK 141 ++Q+ Q+ N+ + + + FD D + + R++ E K Sbjct: 75 LFQISDQS----SNNSAIRDLKEAFDLYDLDRNGRISANELHSVMK 116 Score = 27.5 bits (58), Expect = 4.3 Identities = 7/23 (30%), Positives = 18/23 (78%) Query: 116 VDKIFDQMDKNHDDRLTLEEFRE 138 + K+F + DKN+D +++++E ++ Sbjct: 16 IKKVFQRFDKNNDGKISIDELKD 38 Score = 27.1 bits (57), Expect = 5.7 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 11/70 (15%) Query: 67 EKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKN 126 E + F+ +D +NDG I+ DE+ +++ A+ +P E T K + K FD +D N Sbjct: 14 EDIKKVFQRFDKNNDGKISIDELKDVIGAL------SPNASQEET--KAMMKEFD-LDGN 64 Query: 127 HDDRLTLEEF 136 + L+EF Sbjct: 65 --GFIDLDEF 72 >At4g37010.1 68417.m05243 caltractin, putative / centrin, putative similar to Caltractin (Centrin) SP:P41210 from [Atriplex nummularia] Length = 167 Score = 44.0 bits (99), Expect = 5e-05 Identities = 28/103 (27%), Positives = 54/103 (52%), Gaps = 14/103 (13%) Query: 41 DENNDGSIEFEEFIRALSVT--SRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQ 98 D+N G+I+F+EF+ ++ R ++DE L AF++ D DN+G I+ ++ I + Sbjct: 72 DKNQSGAIDFDEFVHMMTTKFGERDSIDE-LSKAFKIIDHDNNGKISPRDIKMIAKEL-- 128 Query: 99 MVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSK 141 EN ++++ ++ D++ D + LEEF + K Sbjct: 129 ---------GENFTDNDIEEMIEEADRDKDGEVNLEEFMKMMK 162 Score = 27.1 bits (57), Expect = 5.7 Identities = 16/81 (19%), Positives = 29/81 (35%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + F + D S F++ D +N+G I + D + Sbjct: 81 FDEFVHMMTTKFGERDSIDELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEM 140 Query: 73 FRLYDVDNDGYITRDEMYNIV 93 D D DG + +E ++ Sbjct: 141 IEEADRDKDGEVNLEEFMKMM 161 >At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 575 Score = 44.0 bits (99), Expect = 5e-05 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 12/96 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + +G+I++ EFI A R DE L+ AF+ +D D G+IT++E+ Sbjct: 383 DVDGNGTIDYIEFISATMHRHRLERDEHLYKAFQYFDKDGSGHITKEEV----------- 431 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 + E + + + DKN+D ++ EEF Sbjct: 432 -EIAMKEHGMGDEANAKDLISEFDKNNDGKIDYEEF 466 Score = 31.9 bits (69), Expect = 0.20 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 27/89 (30%) Query: 27 GDPSKFASLVFRVFDENNDGSIEFEEF---IRALSVTSRGNLDEKLHW------------ 71 GD + L+ FD+NNDG I++EEF +R + +G L ++L+ Sbjct: 441 GDEANAKDLISE-FDKNNDGKIDYEEFCTMMRNGILQPQGKLLKRLYMNLEELKTGLTRL 499 Query: 72 -----------AFRLYDVDNDGYITRDEM 89 AF+ +D DN G+ITRDE+ Sbjct: 500 GSRLSETEIDKAFQHFDKDNSGHITRDEL 528 >At5g04870.1 68418.m00510 calcium-dependent protein kinase isoform AK1 (AK1) identical to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 610 Score = 43.6 bits (98), Expect = 6e-05 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 13/96 (13%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D +N G+I+++EFI A ++ ++ L AF +D D GYIT DE+ Sbjct: 500 DVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFTYFDKDGSGYITPDELQQAC------- 552 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E+ R++++ +D+++D R+ EF Sbjct: 553 ------EEFGVEDVRIEELMRDVDQDNDGRIDYNEF 582 Score = 26.6 bits (56), Expect = 7.5 Identities = 15/53 (28%), Positives = 22/53 (41%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F + D + G I FEE L + ++ + DVDN G I E Sbjct: 459 MFNMIDADKSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNSGTIDYKE 511 >At5g12480.1 68418.m01466 calmodulin-domain protein kinase isoform 7 (CPK7) identical to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 535 Score = 43.2 bits (97), Expect = 8e-05 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 10/108 (9%) Query: 35 LVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVD 94 ++ D + DG++ + EF+ + DE LH AF +D + GYI DE+ ++ Sbjct: 403 ILMEATDVDGDGTLNYSEFVAVSVHLKKMANDEHLHKAFNFFDQNQSGYIEIDELREALN 462 Query: 95 AIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKA 142 D + ++ + I +D + D R++ EEF KA Sbjct: 463 ----------DELDNTSSEEVIAAIMQDVDTDKDGRISYEEFVAMMKA 500 Score = 31.5 bits (68), Expect = 0.26 Identities = 26/102 (25%), Positives = 39/102 (38%), Gaps = 11/102 (10%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F + D N G I EE L + D L DVD DG + E + + Sbjct: 369 FEMMDVNKRGKINLEELKYGLQKAGQQIADTDLQILMEATDVDGDGTLNYSEFVAVSVHL 428 Query: 97 YQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 +M DE+ + K F+ D+N + ++E RE Sbjct: 429 KKMA------NDEH-----LHKAFNFFDQNQSGYIEIDELRE 459 >At5g17470.1 68418.m02050 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 146 Score = 42.3 bits (95), Expect = 1e-04 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 8/100 (8%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 +F D+N DG I ++EF A+ S E++ FR DVD D I E + + Sbjct: 6 IFERVDKNKDGKISWDEFAEAIRAFSPSITSEEIDNMFREIDVDGDNQIDVAEYASCL-- 63 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEE 135 M+G EDE+ K + FD D + D +++ E Sbjct: 64 ---MLGGEGNKEDEDIVMK---EAFDLYDIDGDGKISASE 97 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEK---LHWAFRLYDVDNDGYITRDEMYNI 92 +FR D + D I+ E+ L + GN +++ + AF LYD+D DG I+ E++ + Sbjct: 42 MFREIDVDGDNQIDVAEYASCLMLGGEGNKEDEDIVMKEAFDLYDIDGDGKISASEIHVV 101 Query: 93 V 93 + Sbjct: 102 L 102 Score = 29.1 bits (62), Expect = 1.4 Identities = 11/27 (40%), Positives = 20/27 (74%) Query: 116 VDKIFDQMDKNHDDRLTLEEFREGSKA 142 V +IF+++DKN D +++ +EF E +A Sbjct: 3 VAEIFERVDKNKDGKISWDEFAEAIRA 29 >At4g03290.1 68417.m00449 calcium-binding protein, putative similar to calcium-binding protein [Lotus japonicus] GI:18413495; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 154 Score = 42.3 bits (95), Expect = 1e-04 Identities = 30/117 (25%), Positives = 56/117 (47%), Gaps = 13/117 (11%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEF---IRALSVTSRGNL-DEKLHWAFRLYDVDNDGYI 84 P + + + D N DG ++ EEF + + V + +E + AF ++D + DG+I Sbjct: 38 PEDELTQIIQKIDVNGDGCVDIEEFGELYKTIMVEDEDEVGEEDMKEAFNVFDRNGDGFI 97 Query: 85 TRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSK 141 T DE+ ++ ++ G+T + K+ Q+D + D R+ EFR+ K Sbjct: 98 TVDELKAVLSSLGLKQGKT---------LEECRKMIMQVDVDGDGRVNYMEFRQMMK 145 Score = 34.7 bits (76), Expect = 0.028 Identities = 26/102 (25%), Positives = 51/102 (50%), Gaps = 7/102 (6%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 VF++FD++ DG I +E + +++L + DV+ DG + +E + Sbjct: 9 VFQMFDKDGDGKITTKELNESFKNLGIIIPEDELTQIIQKIDVNGDGCVDIEEFGELYKT 68 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 I MV + EDE ++ + + F+ D+N D +T++E + Sbjct: 69 I--MV----EDEDE-VGEEDMKEAFNVFDRNGDGFITVDELK 103 Score = 29.9 bits (64), Expect = 0.81 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 11/71 (15%) Query: 68 KLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNH 127 +L+ F+++D D DG IT E+ + ++ PEDE T +I ++D N Sbjct: 5 ELNRVFQMFDKDGDGKITTKELNESFKNLGIII-----PEDELT------QIIQKIDVNG 53 Query: 128 DDRLTLEEFRE 138 D + +EEF E Sbjct: 54 DGCVDIEEFGE 64 >At1g05990.1 68414.m00627 calcium-binding protein, putative strong similarity to calcium-binding protein [Lotus japonicus] GI:18413495; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 150 Score = 42.3 bits (95), Expect = 1e-04 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 11/115 (9%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEF--IRALSVTSRGNLDEKLHWAFRLYDVDNDGYITR 86 P K + + D N DG ++ +EF + + +E + AF ++D + DG+IT Sbjct: 38 PDKELTQMIEKIDVNGDGCVDIDEFGELYKTIMDEEDEEEEDMKEAFNVFDQNGDGFITV 97 Query: 87 DEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSK 141 DE+ ++ ++ G+T K+ ++D + D R+ +EFR+ K Sbjct: 98 DELKAVLSSLGLKQGKTLDD---------CKKMIKKVDVDGDGRVNYKEFRQMMK 143 Score = 40.3 bits (90), Expect = 6e-04 Identities = 28/110 (25%), Positives = 53/110 (48%), Gaps = 10/110 (9%) Query: 28 DPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRD 87 DP++ VF++FD+N DG+I +E L D++L DV+ DG + D Sbjct: 2 DPTELKR-VFQMFDKNGDGTITGKELSETLRSLGIYIPDKELTQMIEKIDVNGDGCVDID 60 Query: 88 EMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 E + I ++E+ ++ + + F+ D+N D +T++E + Sbjct: 61 EFGELYKTIM---------DEEDEEEEDMKEAFNVFDQNGDGFITVDELK 101 >At2g17290.1 68415.m01997 calcium-dependent protein kinase isoform 6 (CPK6) identical to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 544 Score = 41.9 bits (94), Expect = 2e-04 Identities = 20/49 (40%), Positives = 30/49 (61%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 D +N G+I++ EFI A ++ +E L AF+ +D D GYIT DE+ Sbjct: 435 DVDNSGTIDYSEFIAATIHLNKLEREEHLVSAFQYFDKDGSGYITIDEL 483 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/53 (30%), Positives = 22/53 (41%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F D +N G+I F+E L D ++ DVDN G I E Sbjct: 394 MFEAMDTDNSGAITFDELKAGLRRYGSTLKDTEIRDLMEAADVDNSGTIDYSE 446 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSVTSRG 63 F + + D++NDG I++EEF+ + + G Sbjct: 496 FLEDIIKEVDQDNDGRIDYEEFVAMMQKGNAG 527 >At3g03400.1 68416.m00337 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 137 Score = 41.5 bits (93), Expect = 2e-04 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 3/68 (4%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSVT---SRGNLDEKLHWAFRLYDVDNDGYIT 85 PS+ +F D N DG ++ +F + T S G+++++L AF+LYD++ DG I+ Sbjct: 38 PSEKLVEMFIQLDTNGDGQVDAAKFASCMDQTAQSSGGDVEKELKDAFKLYDINCDGKIS 97 Query: 86 RDEMYNIV 93 +E++ ++ Sbjct: 98 ANELHVVM 105 Score = 37.1 bits (82), Expect = 0.005 Identities = 36/129 (27%), Positives = 54/129 (41%), Gaps = 17/129 (13%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 +F FD + DG I +EEF A+ S EKL F D + DG + + + +D Sbjct: 9 IFERFDTSKDGKISWEEFRDAIHALSPSIPSEKLVEMFIQLDTNGDGQVDAAKFASCMD- 67 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF-----REGSKADPR----I 146 QT Q + +K + F D N D +++ E R G K + Sbjct: 68 ------QTAQSSGGDV-EKELKDAFKLYDINCDGKISANELHVVMTRLGEKCTVESCVGM 120 Query: 147 VQALSLGGD 155 VQA+ + GD Sbjct: 121 VQAIDVDGD 129 >At2g36180.1 68415.m04440 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 144 Score = 41.5 bits (93), Expect = 2e-04 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 9/110 (8%) Query: 16 FIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEK----LHW 71 F + + F PQ S+ +F V D + DG I+ EF L V G D + + Sbjct: 21 FAEAIRVFSPQ-ITSEEIDKMFIVLDVDGDGQIDDVEFASCLMVNGGGEKDTEEEVVMKE 79 Query: 72 AFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFD 121 AF LYD+D DG I+ E++ + + +G+ ED + VDK D Sbjct: 80 AFDLYDMDGDGKISASEIH----VVLKRLGEKHTMEDCVVMVQTVDKDSD 125 Score = 38.7 bits (86), Expect = 0.002 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 7/100 (7%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 +F D+N DG I ++EF A+ V S E++ F + DVD DG I E + + Sbjct: 4 IFESVDKNKDGKILWDEFAEAIRVFSPQITSEEIDKMFIVLDVDGDGQIDDVEFASCL-- 61 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEE 135 + G + +E K + FD D + D +++ E Sbjct: 62 --MVNGGGEKDTEEEVVMK---EAFDLYDMDGDGKISASE 96 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 41.1 bits (92), Expect = 3e-04 Identities = 28/108 (25%), Positives = 58/108 (53%), Gaps = 16/108 (14%) Query: 31 KFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 K+A +FRV D N DG ++++EF R + + +L+ F+ DV+++G I +E++ Sbjct: 72 KYARDLFRVCDANRDGRVDYQEFRRYIDAK-----ELELYRIFQAIDVEHNGCILPEELW 126 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 +V + +DE + + + +DK+++ +T EE+R+ Sbjct: 127 E------ALVKAGIEIDDE-----ELARFVEHVDKDNNGTITFEEWRD 163 >At4g32060.1 68417.m04563 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 498 Score = 41.1 bits (92), Expect = 3e-04 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 6/65 (9%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 PS+F F +FD +NDG I F+E+I VT + AF+++D DN+G I ++E Sbjct: 214 PSEF----FMLFDVDNDGLISFKEYI--FFVTLLSIPESSFAVAFKMFDTDNNGEIDKEE 267 Query: 89 MYNIV 93 ++ Sbjct: 268 FKTVM 272 Score = 31.5 bits (68), Expect = 0.26 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 35 LVFRVFDENNDGSIEFEEFIRAL 57 + F VFD N DG++ +EF+R L Sbjct: 444 IAFHVFDSNQDGNLSVDEFLRVL 466 Score = 28.7 bits (61), Expect = 1.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSV 59 P ++ F++FD +N+G I+ EEF +S+ Sbjct: 244 PESSFAVAFKMFDTDNNGEIDKEEFKTVMSL 274 Score = 27.5 bits (58), Expect = 4.3 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Query: 17 IKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNL-DEKLHWAFRL 75 +K +KQF SL + + N G + ++F RA S L D + AF + Sbjct: 390 LKEFKQFDELRSKLGPFSLALFAYGKAN-GLLTMKDFKRAASQVCGITLSDNVIEIAFHV 448 Query: 76 YDVDNDGYITRDEMYNIV 93 +D + DG ++ DE ++ Sbjct: 449 FDSNQDGNLSVDEFLRVL 466 >At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to calmodulin GI:474183 from [Arabidopsis thaliana]; almost identical to calmodulin-2/3/5 SP:P25069 [Arabidopsis thaliana] Length = 149 Score = 41.1 bits (92), Expect = 3e-04 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRG-NLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D + +G+I+F EF+ ++ + + +E+L AFR++D D +G+I+ E+ +++ + Sbjct: 57 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNL--- 113 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E + VD++ + D + D ++ EEF Sbjct: 114 --------GEKLTDEEVDEMIKEADVDGDGQINYEEF 142 Score = 36.3 bits (80), Expect = 0.009 Identities = 21/83 (25%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 + DVD DG I +E ++ A Sbjct: 126 IKEADVDGDGQINYEEFVKVMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 >At3g10660.1 68416.m01282 calcium-dependent protein kinase isoform 2 (CPK2) identical to calcium-dependent protein kinase isoform 2 [Arabidopsis thaliana] gi|9837343|gb|AAG00535; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 646 Score = 41.1 bits (92), Expect = 3e-04 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 13/96 (13%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D +N G+I+++EFI A ++ ++ L AF +D D G+IT DE+ Sbjct: 536 DVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFSYFDKDESGFITPDELQQAC------- 588 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E+ R++++ +D++ D R+ EF Sbjct: 589 ------EEFGVEDARIEEMMRDVDQDKDGRIDYNEF 618 Score = 29.9 bits (64), Expect = 0.81 Identities = 16/53 (30%), Positives = 24/53 (45%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F++ D +N G I FEE L + ++ + DVDN G I E Sbjct: 495 MFKMIDADNSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNSGTIDYKE 547 >At3g07490.1 68416.m00893 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 153 Score = 41.1 bits (92), Expect = 3e-04 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 10/102 (9%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 +F++FD N DG I +E +L D+ L D++ DGY+ +E Sbjct: 9 IFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKIDLNGDGYVDIEEF----GG 64 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 +YQ + + DE + +FDQ N D +T+EE R Sbjct: 65 LYQTI---MEERDEEEDMREAFNVFDQ---NRDGFITVEELR 100 Score = 38.3 bits (85), Expect = 0.002 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 1/76 (1%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRAL-SVTSRGNLDEKLHWAFRLYDVDNDGYITRD 87 P K + D N DG ++ EEF ++ + +E + AF ++D + DG+IT + Sbjct: 38 PDKDLVQMIEKIDLNGDGYVDIEEFGGLYQTIMEERDEEEDMREAFNVFDQNRDGFITVE 97 Query: 88 EMYNIVDAIYQMVGQT 103 E+ +++ ++ G+T Sbjct: 98 ELRSVLASLGLKQGRT 113 Score = 32.3 bits (70), Expect = 0.15 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 2/72 (2%) Query: 19 IYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSV--TSRGNLDEKLHWAFRLY 76 +Y+ + D + F VFD+N DG I EE L+ +G E Sbjct: 65 LYQTIMEERDEEEDMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCKRMISKV 124 Query: 77 DVDNDGYITRDE 88 DVD DG + E Sbjct: 125 DVDGDGMVNFKE 136 >At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identical to calmodulin-like MSS3 from GI:9965747 [Arabidopsis thaliana] Length = 215 Score = 41.1 bits (92), Expect = 3e-04 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 6/110 (5%) Query: 28 DPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRD 87 DPS+ VF++FD+N DG I EE +L D+ L D + DG + D Sbjct: 62 DPSELKR-VFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDANGDGCVDID 120 Query: 88 EMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 E ++ +I D T ++ + F+ D++ D +T+EE + Sbjct: 121 EFESLYSSIVD-----EHHNDGETEEEDMKDAFNVFDQDGDGFITVEELK 165 Score = 38.3 bits (85), Expect = 0.002 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 15/119 (12%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALS--VTSRGN----LDEKLHWAFRLYDVDNDG 82 P K + + D N DG ++ +EF S V N +E + AF ++D D DG Sbjct: 98 PDKDLTQMIHKIDANGDGCVDIDEFESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDG 157 Query: 83 YITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSK 141 +IT +E+ +++ ++ G+T K+ Q+D + D R+ +EF + K Sbjct: 158 FITVEELKSVMASLGLKQGKT---------LDGCKKMIMQVDADGDGRVNYKEFLQMMK 207 Score = 33.9 bits (74), Expect = 0.050 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Query: 104 PQPEDENTPQKRVD-----KIFDQMDKNHDDRLTLEEFRE 138 P P + P KR+D ++F DKN D R+T EE + Sbjct: 49 PSPSSSSAPTKRIDPSELKRVFQMFDKNGDGRITKEELND 88 >At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost identical to Calmodulin-2/3/5 SP:P25069 from [Arabidopsis thaliana] Length = 149 Score = 41.1 bits (92), Expect = 3e-04 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRG-NLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D + +G+I+F EF+ ++ + + +E+L AFR++D D +G+I+ E+ +++ + Sbjct: 57 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNL--- 113 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E + VD++ + D + D ++ EEF Sbjct: 114 --------GEKLTDEEVDEMIKEADVDGDGQINYEEF 142 Score = 36.3 bits (80), Expect = 0.009 Identities = 21/83 (25%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 + DVD DG I +E ++ A Sbjct: 126 IKEADVDGDGQINYEEFVKVMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 >At2g31500.1 68415.m03848 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 582 Score = 41.1 bits (92), Expect = 3e-04 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 12/126 (9%) Query: 17 IKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLY 76 +K Q P GD ++ D + +G + +EF+ R DE L AF+ + Sbjct: 396 LKKIGQVVPDGD----VKMLMDAADTDGNGMLSCDEFVTLSIHLKRMGCDEHLQEAFKYF 451 Query: 77 DVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 D + +G+I DE+ V +G N + + IF +D N D R++ +EF Sbjct: 452 DKNGNGFIELDELK--VALCDDKLGHA------NGNDQWIKDIFFDVDLNKDGRISFDEF 503 Query: 137 REGSKA 142 + K+ Sbjct: 504 KAMMKS 509 >At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 181 Score = 41.1 bits (92), Expect = 3e-04 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRG-NLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D + +G+I+F EF+ ++ + + +E+L AFR++D D +G+I+ E+ +++ + Sbjct: 57 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNL--- 113 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E + VD++ + D + D ++ EEF Sbjct: 114 --------GEKLTDEEVDEMIKEADVDGDGQINYEEF 142 Score = 36.3 bits (80), Expect = 0.009 Identities = 21/83 (25%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 + DVD DG I +E ++ A Sbjct: 126 IKEADVDGDGQINYEEFVKVMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 41 DENNDGSIEFEEFIRALSVTSRG 63 D + DG I +EEF++ + RG Sbjct: 130 DVDGDGQINYEEFVKVMMAKRRG 152 >At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 113 Score = 41.1 bits (92), Expect = 3e-04 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRG-NLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D + +G+I+F EF+ ++ + + +E+L AFR++D D +G+I+ E+ +++ + Sbjct: 21 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNL--- 77 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E + VD++ + D + D ++ EEF Sbjct: 78 --------GEKLTDEEVDEMIKEADVDGDGQINYEEF 106 Score = 36.3 bits (80), Expect = 0.009 Identities = 21/83 (25%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 30 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 89 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 + DVD DG I +E ++ A Sbjct: 90 IKEADVDGDGQINYEEFVKVMMA 112 >At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 149 Score = 41.1 bits (92), Expect = 3e-04 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRG-NLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D + +G+I+F EF+ ++ + + +E+L AFR++D D +G+I+ E+ +++ + Sbjct: 57 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNL--- 113 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E + VD++ + D + D ++ EEF Sbjct: 114 --------GEKLTDEEVDEMIKEADVDGDGQINYEEF 142 Score = 36.3 bits (80), Expect = 0.009 Identities = 21/83 (25%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 + DVD DG I +E ++ A Sbjct: 126 IKEADVDGDGQINYEEFVKVMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 >At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmodulin-6 SP:Q03509 from [Arabidopsis thaliana]; contains Pfam profile: PF00036 EF hand Length = 149 Score = 40.7 bits (91), Expect = 4e-04 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRG-NLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D + +G+I+F EF+ ++ + + +E+L AFR++D D +G+I+ E+ +++ + Sbjct: 57 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNL--- 113 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E + VD++ + D + D ++ EEF Sbjct: 114 --------GEKLSDEEVDEMIREADVDGDGQINYEEF 142 Score = 37.1 bits (82), Expect = 0.005 Identities = 22/83 (26%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 R DVD DG I +E ++ A Sbjct: 126 IREADVDGDGQINYEEFVKVMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 >At4g34070.1 68417.m04834 expressed protein Length = 363 Score = 40.7 bits (91), Expect = 4e-04 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 10/123 (8%) Query: 34 SLVFRVFD----ENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 SL R+FD D + FE+ + A + +G DE + ++ DV+ +G + R ++ Sbjct: 156 SLGERIFDMVTQHRKDDKMTFEDLVIAKATYEKGTDDEIAEFIYQTLDVNGNGVLRRSDL 215 Query: 90 YNIVDAIYQMVGQTPQPEDENTPQKR-VDKI-----FDQMDKNHDDRLTLEEFREGSKAD 143 + + I + V T + E++ K VD + F + D + ++ E+FR Sbjct: 216 ESFLVVILKSVFSTESSDAESSDYKEMVDALLDAATFSKSDDGSEKGMSFEDFRSWCPLV 275 Query: 144 PRI 146 P I Sbjct: 276 PTI 278 >At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to calmodulin GI:16227 from [Arabidopsis thaliana], SP|P59220 Calmodulin-7 {Arabidopsis thaliana} Length = 149 Score = 40.7 bits (91), Expect = 4e-04 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVTSRG-NLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D + +G+I+F EF+ ++ + + +E+L AFR++D D +G+I+ E+ +++ + Sbjct: 57 DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNL--- 113 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 E + VD++ + D + D ++ EEF Sbjct: 114 --------GEKLTDEEVDEMIREADVDGDGQINYEEF 142 Score = 37.5 bits (83), Expect = 0.004 Identities = 22/83 (26%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 R DVD DG I +E ++ A Sbjct: 126 IREADVDGDGQINYEEFVKVMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 >At4g35310.1 68417.m05019 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 556 Score = 40.3 bits (90), Expect = 6e-04 Identities = 19/49 (38%), Positives = 30/49 (61%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 D +N G+I++ EFI A ++ +E L AF+ +D D G+IT DE+ Sbjct: 447 DVDNSGTIDYSEFIAATIHLNKLEREEHLVAAFQYFDKDGSGFITIDEL 495 Score = 31.5 bits (68), Expect = 0.26 Identities = 17/53 (32%), Positives = 24/53 (45%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F+ D +N G+I F+E L D ++H DVDN G I E Sbjct: 406 MFQAMDTDNSGAITFDELKAGLRKYGSTLKDTEIHDLMDAADVDNSGTIDYSE 458 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSVTSRG 63 F + + D+NNDG I++ EF+ + + G Sbjct: 508 FLEDIIKEVDQNNDGKIDYGEFVEMMQKGNAG 539 >At3g03000.1 68416.m00295 calmodulin, putative similar to calmodulin SP:P04352 from [Chlamydomonas reinhardtii]; contains Pfam profile: PF00036 EF hand (4 copies) Length = 165 Score = 40.3 bits (90), Expect = 6e-04 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query: 41 DENNDGSIEFEEFIRALS--VTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 D NN+G +EF EF+ + + D++L FR++D D +GYIT E+ Sbjct: 65 DRNNNGLVEFSEFVALVEPDLVKCPYTDDQLKAIFRMFDRDGNGYITAAEL 115 Score = 28.7 bits (61), Expect = 1.9 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Query: 36 VFRVFDENNDGS---IEFEEFIRALSV-TSRGNLDEKLHWAFRLYDVDNDGYITRDEMYN 91 +FR FD+N DGS +E +R+L + S+ LD + A D +N+G + E Sbjct: 24 IFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIQKA----DRNNNGLVEFSEFVA 79 Query: 92 IVD 94 +V+ Sbjct: 80 LVE 82 Score = 27.9 bits (59), Expect = 3.3 Identities = 15/58 (25%), Positives = 25/58 (43%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 +FR+FD + +G I E +++ E+L + D D DG I E + Sbjct: 98 IFRMFDRDGNGYITAAELAHSMAKLGHALTAEELTGMIKEADRDGDGCIDFQEFVQAI 155 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/24 (37%), Positives = 17/24 (70%) Query: 41 DENNDGSIEFEEFIRALSVTSRGN 64 D + DG I+F+EF++A++ + N Sbjct: 139 DRDGDGCIDFQEFVQAITSAAFDN 162 >At4g38230.1 68417.m05399 calcium-dependent protein kinase, putative / CDPK, putative calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 340 Score = 39.9 bits (89), Expect = 8e-04 Identities = 20/49 (40%), Positives = 29/49 (59%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 D + G+I++ EFI A ++ +E L AFR +D D GYIT DE+ Sbjct: 230 DIDKSGTIDYGEFIAATIHLNKLEREEHLLSAFRYFDKDGSGYITIDEL 278 Score = 26.6 bits (56), Expect = 7.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 26 QGDPSKFASLVFRVFDENNDGSIEFEEFI 54 QG F V + D++NDG I++ EF+ Sbjct: 285 QGMSDVFLEDVIKEVDQDNDGRIDYGEFV 313 >At4g36070.1 68417.m05135 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 536 Score = 39.9 bits (89), Expect = 8e-04 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 18/108 (16%) Query: 36 VFRVFDENNDGSIEFEEFI-RALSVTSRGNLD-----EKLHWAFRLYDVDNDGYITRDEM 89 + + D N DG ++F EF+ AL V D ++ AF +D+D DG+IT +E+ Sbjct: 416 ILQANDSNTDGLVDFTEFVVAALHVNQLEEHDSEKWQQRSRAAFDKFDIDGDGFITPEEL 475 Query: 90 YNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 + Q + QT + ++ + ++ D + D R+++ EFR Sbjct: 476 -----RLNQCLQQTGL-------KGSIEPLLEEADVDEDGRISINEFR 511 >At4g27790.1 68417.m03991 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 345 Score = 39.9 bits (89), Expect = 8e-04 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 7/105 (6%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRL----YDVDNDGYITRDEMYNI 92 F+ D +++GS++ EEF L N D + W + D + DG + E Sbjct: 179 FKNSDFDHNGSLDIEEFNNFLHPEDSRNGDTQ-RWVLKERMTGMDTNGDGKLEYKEFVKN 237 Query: 93 VDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 +Y+ + + EDEN P ++ +F +MD++ D L +E R Sbjct: 238 AYEMYKEFAKFEKEEDENVPTPQL--LFAEMDRDKDRFLVADELR 280 Score = 28.3 bits (60), Expect = 2.5 Identities = 22/99 (22%), Positives = 43/99 (43%), Gaps = 6/99 (6%) Query: 5 YIKKPFCVFQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGN 64 ++K + +++ F K K+ + + L+F D + D + +E L G Sbjct: 234 FVKNAYEMYKEFAKFEKE---EDENVPTPQLLFAEMDRDKDRFLVADELRPILQYLQPGE 290 Query: 65 LD-EKLHWAFRLY--DVDNDGYITRDEMYNIVDAIYQMV 100 + K + F + D D DG ++ +EM + D Y+ V Sbjct: 291 MSYAKFYSTFLCHEADEDKDGKLSLEEMLHHEDVFYKAV 329 >At4g09570.1 68417.m01575 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 501 Score = 39.9 bits (89), Expect = 8e-04 Identities = 19/49 (38%), Positives = 29/49 (59%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 D +N G+I++ EF+ A ++ +E L AF +D D GYIT DE+ Sbjct: 375 DIDNSGTIDYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITIDEL 423 Score = 30.7 bits (66), Expect = 0.46 Identities = 15/53 (28%), Positives = 25/53 (47%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F++ D +N G+I FEE L ++ ++ D+DN G I E Sbjct: 334 LFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADIDNSGTIDYGE 386 >At3g59440.1 68416.m06630 calcium-binding protein, putative similar to calcium-binding protein [Lotus japonicus] GI:18413495 Length = 195 Score = 39.9 bits (89), Expect = 8e-04 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 9/114 (7%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 P K + + D N DG ++ EF + + AF ++D D DG+IT +E Sbjct: 84 PDKDLIQMIQKMDANGDGCVDINEFESLYGSIVEEKEEGDMRDAFNVFDQDGDGFITVEE 143 Query: 89 MYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKA 142 + +++ ++ G+T + E + Q+D++ D R+ +EF + K+ Sbjct: 144 LNSVMTSLGLKQGKTLECCKE---------MIMQVDEDGDGRVNYKEFLQMMKS 188 Score = 33.5 bits (73), Expect = 0.066 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Query: 102 QTPQPEDENTPQKRVD--KIFDQMDKNHDDRLTLEEFRE 138 + P P DE+ + VD ++F DKN D R+T EE + Sbjct: 36 KNPPPPDESETESPVDLKRVFQMFDKNGDGRITKEELND 74 Score = 31.5 bits (68), Expect = 0.26 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 11/100 (11%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 VF++FD+N DG I EE +L D+ L + D + DG + +E ++ + Sbjct: 55 VFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQMIQKMDANGDGCVDINEFESLYGS 114 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEE 135 I + E E + +FDQ + D +T+EE Sbjct: 115 IVE--------EKEEGDMRDAFNVFDQ---DGDGFITVEE 143 >At1g74740.1 68414.m08660 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 541 Score = 39.9 bits (89), Expect = 8e-04 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 13/110 (11%) Query: 27 GDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITR 86 G+P L+ V D N +G +++ EF+ + + DE AF +D D GYI Sbjct: 397 GEPE--IKLLMEVADVNGNGCLDYGEFVAVIIHLQKMENDEHFRQAFMFFDKDGSGYIES 454 Query: 87 DEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 +E+ +A+ +G E +N+ + I ++D + D ++ +EF Sbjct: 455 EELR---EALTDELG-----EPDNSV---IIDIMREVDTDKDGKINYDEF 493 >At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDPK2) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 495 Score = 39.9 bits (89), Expect = 8e-04 Identities = 19/49 (38%), Positives = 29/49 (59%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 D +N G+I++ EF+ A ++ +E L AF +D D GYIT DE+ Sbjct: 376 DIDNSGTIDYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDEL 424 Score = 30.7 bits (66), Expect = 0.46 Identities = 15/53 (28%), Positives = 25/53 (47%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F++ D +N G+I FEE L ++ ++ D+DN G I E Sbjct: 335 LFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADIDNSGTIDYGE 387 >At1g61950.1 68414.m06988 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GI:3283996 from [Nicotiana tabacum]; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 551 Score = 39.5 bits (88), Expect = 0.001 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 8/99 (8%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM------YNIVD 94 D + +G+I++ EFI A R ++ L AF+ +D DN G+I+R E+ YN+ D Sbjct: 449 DVDGNGTIDYIEFISATMNRFRVEREDNLFKAFQHFDKDNSGFISRQELETAMKEYNMGD 508 Query: 95 --AIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRL 131 I +++ + D + + + ++H +L Sbjct: 509 DIMIKEIISEVDADNDGSINYQEFCNMMKSCSQSHQSKL 547 Score = 31.1 bits (67), Expect = 0.35 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F+ FD++N G I +E A+ + G+ D + D DNDG I E N++ + Sbjct: 481 FQHFDKDNSGFISRQELETAMKEYNMGD-DIMIKEIISEVDADNDGSINYQEFCNMMKSC 539 Query: 97 YQ 98 Q Sbjct: 540 SQ 541 >At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CDPK19) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655 Length = 533 Score = 39.1 bits (87), Expect = 0.001 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 15/128 (11%) Query: 15 GFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFR 74 G K+ +Q P D ++ D + DG++ + EF+ + DE LH AF Sbjct: 386 GLHKLGQQQIPDTD----LQILMEAADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFS 441 Query: 75 LYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLE 134 +D + YI +E+ ++ E + ++ V I +D + D R++ E Sbjct: 442 FFDQNQSDYIEIEELREALN-----------DEVDTNSEEVVAAIMQDVDTDKDGRISYE 490 Query: 135 EFREGSKA 142 EF KA Sbjct: 491 EFAAMMKA 498 >At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CDPK19) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655 Length = 533 Score = 39.1 bits (87), Expect = 0.001 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 15/128 (11%) Query: 15 GFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFR 74 G K+ +Q P D ++ D + DG++ + EF+ + DE LH AF Sbjct: 386 GLHKLGQQQIPDTD----LQILMEAADVDGDGTLNYGEFVAVSVHLKKMANDEHLHKAFS 441 Query: 75 LYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLE 134 +D + YI +E+ ++ E + ++ V I +D + D R++ E Sbjct: 442 FFDQNQSDYIEIEELREALN-----------DEVDTNSEEVVAAIMQDVDTDKDGRISYE 490 Query: 135 EFREGSKA 142 EF KA Sbjct: 491 EFAAMMKA 498 >At4g12860.1 68417.m02014 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 152 Score = 38.7 bits (86), Expect = 0.002 Identities = 25/99 (25%), Positives = 52/99 (52%), Gaps = 10/99 (10%) Query: 41 DENNDGSIEFEEFIRALS-VTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D N DG+++ +EF + +E + AFR++D + DG+IT +E+ +++ ++ Sbjct: 50 DVNGDGAMDIDEFGSLYQEMVEEKEEEEDMREAFRVFDQNGDGFITDEELRSVLASMGLK 109 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 G+T ED K+ ++D + D + +EF++ Sbjct: 110 QGRT--LED-------CKKMISKVDVDGDGMVNFKEFKQ 139 Score = 37.1 bits (82), Expect = 0.005 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 16/107 (14%) Query: 34 SLVFRVFDENNDGSI---EFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 S VF++FD+N DG I E ++F +++ + N +++ DV+ DG + DE Sbjct: 7 SRVFQMFDKNGDGKIAKNELKDFFKSVGIMVPEN---EINEMIAKMDVNGDGAMDIDEF- 62 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 ++YQ + + ++E + ++FDQ N D +T EE R Sbjct: 63 ---GSLYQ---EMVEEKEEEEDMREAFRVFDQ---NGDGFITDEELR 100 Score = 33.5 bits (73), Expect = 0.066 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 2/75 (2%) Query: 16 FIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEF--IRALSVTSRGNLDEKLHWAF 73 F +Y++ + + + FRVFD+N DG I EE + A +G E Sbjct: 62 FGSLYQEMVEEKEEEEDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKMI 121 Query: 74 RLYDVDNDGYITRDE 88 DVD DG + E Sbjct: 122 SKVDVDGDGMVNFKE 136 Score = 29.1 bits (62), Expect = 1.4 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 11/69 (15%) Query: 68 KLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNH 127 +L F+++D + DG I ++E+ + ++ MV P+ ++++ +MD N Sbjct: 5 ELSRVFQMFDKNGDGKIAKNELKDFFKSVGIMV-----------PENEINEMIAKMDVNG 53 Query: 128 DDRLTLEEF 136 D + ++EF Sbjct: 54 DGAMDIDEF 62 >At2g41860.2 68415.m05174 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 530 Score = 38.7 bits (86), Expect = 0.002 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 15/98 (15%) Query: 41 DENNDGSIEFEEFIRALSVTSR--GNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQ 98 D + DG ++ EF+ A+SV R GN DE L AF +D + GYI +E+ DA+ Sbjct: 404 DVDKDGYLDVNEFV-AISVHIRKLGN-DEHLKKAFTFFDKNKSGYIEIEELR---DALAD 458 Query: 99 MVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 V + T ++ V+ I +D N D +++ +EF Sbjct: 459 DV--------DTTSEEVVEAIILDVDTNKDGKISYDEF 488 Score = 27.1 bits (57), Expect = 5.7 Identities = 28/107 (26%), Positives = 41/107 (38%), Gaps = 11/107 (10%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F+V D +N G I E L + + DVD DGY+ +E I I Sbjct: 364 FQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDVDKDGYLDVNEFVAISVHI 423 Query: 97 YQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKAD 143 ++ DE+ + K F DKN + +EE R+ D Sbjct: 424 RKL------GNDEH-----LKKAFTFFDKNKSGYIEIEELRDALADD 459 >At2g41860.1 68415.m05173 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 425 Score = 38.7 bits (86), Expect = 0.002 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 15/98 (15%) Query: 41 DENNDGSIEFEEFIRALSVTSR--GNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQ 98 D + DG ++ EF+ A+SV R GN DE L AF +D + GYI +E+ DA+ Sbjct: 299 DVDKDGYLDVNEFV-AISVHIRKLGN-DEHLKKAFTFFDKNKSGYIEIEELR---DALAD 353 Query: 99 MVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 V + T ++ V+ I +D N D +++ +EF Sbjct: 354 DV--------DTTSEEVVEAIILDVDTNKDGKISYDEF 383 Score = 27.1 bits (57), Expect = 5.7 Identities = 28/107 (26%), Positives = 41/107 (38%), Gaps = 11/107 (10%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F+V D +N G I E L + + DVD DGY+ +E I I Sbjct: 259 FQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDVDKDGYLDVNEFVAISVHI 318 Query: 97 YQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKAD 143 ++ DE+ + K F DKN + +EE R+ D Sbjct: 319 RKL------GNDEH-----LKKAFTFFDKNKSGYIEIEELRDALADD 354 >At2g17890.1 68415.m02072 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 571 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHW------AFRLYDVDNDGYITRDEM 89 + + D N DG ++F EF+ A ++ + W AF +D+D DG+IT +E+ Sbjct: 456 ILQAIDSNTDGFVDFGEFVAAALHVNQLEEHDSEKWQQRSRAAFEKFDIDGDGFITAEEL 515 Score = 26.6 bits (56), Expect = 7.5 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F FD + DG I EE + +G+++ L A D+DNDG I+ E ++ Sbjct: 499 FEKFDIDGDGFITAEEL--RMHTGLKGSIEPLLEEA----DIDNDGKISLQEFRRLL 549 >At5g66210.2 68418.m08341 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 38.3 bits (85), Expect = 0.002 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHW------AFRLYDVDNDGYITRDEM 89 + D N DG ++F EF+ A + + W AF +D+D DGYIT +E+ Sbjct: 410 ILEAIDSNTDGLVDFTEFVAAALHVHQLEEHDSEKWQLRSRAAFEKFDLDKDGYITPEEL 469 >At5g66210.1 68418.m08340 calcium-dependent protein kinase family protein / CDPK family protein contains Pfam domains, PF00069: Protein kinase domain and PF00036: EF hand Length = 523 Score = 38.3 bits (85), Expect = 0.002 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHW------AFRLYDVDNDGYITRDEM 89 + D N DG ++F EF+ A + + W AF +D+D DGYIT +E+ Sbjct: 410 ILEAIDSNTDGLVDFTEFVAAALHVHQLEEHDSEKWQLRSRAAFEKFDLDKDGYITPEEL 469 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 38.3 bits (85), Expect = 0.002 Identities = 27/108 (25%), Positives = 58/108 (53%), Gaps = 16/108 (14%) Query: 31 KFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 K+A +FRV D N DG +++ EF R + + + +L+ F+ DV+++G I+ + ++ Sbjct: 75 KYAKELFRVCDANRDGRVDYHEFRRYMD-----DKELELYRIFQAIDVEHNGCISPEGLW 129 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 + +V + +DE + + + +DK++D + EE+R+ Sbjct: 130 D------SLVKAGIEIKDE-----ELARFVEHVDKDNDGIIMFEEWRD 166 >At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calmodulin 4 [Arabidopsis thaliana] GI:16223, SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 38.3 bits (85), Expect = 0.002 Identities = 23/83 (27%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 R DVD DG I +E I+ A Sbjct: 126 IREADVDGDGQINYEEFVKIMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 >At3g50360.1 68416.m05507 caltractin / centrin identical to caltractin; centrin GI:3688162 from [Arabidopsis thaliana] Length = 169 Score = 38.3 bits (85), Expect = 0.002 Identities = 21/97 (21%), Positives = 50/97 (51%), Gaps = 12/97 (12%) Query: 41 DENNDGSIEFEEFIRALSVT-SRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQM 99 D++ G+I+F+EF+ ++ + E+L AF++ D+D +G I+ D++ + + Sbjct: 72 DKDGSGAIDFDEFVHMMTAKIGERDTKEELTKAFQIIDLDKNGKISPDDIKRMAKDL--- 128 Query: 100 VGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 EN + ++ ++ D++ D + ++EF Sbjct: 129 --------GENFTDAEIREMVEEADRDRDGEVNMDEF 157 Score = 27.1 bits (57), Expect = 5.7 Identities = 15/59 (25%), Positives = 28/59 (47%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 F +FD + G+I+ +E A+ +E+++ D D G I DE +++ A Sbjct: 32 FELFDTDGSGTIDAKELNVAMRALGFEMTEEQINKMIADVDKDGSGAIDFDEFVHMMTA 90 >At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein, 22 kDa (CaBP-22) identical to SP|P30187 22 kDa calmodulin-like calcium-binding protein (CABP-22) [Arabidopsis thaliana] Length = 191 Score = 38.3 bits (85), Expect = 0.002 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 13/96 (13%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 D + DG+I F EF+ A++ + D K FRL+D+D +G+I+ EM + + + Sbjct: 57 DLDGDGTINFTEFLCAMAKDTYSEKDLKKD--FRLFDIDKNGFISAAEMRYV-----RTI 109 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 + Q ++E +D+I D + D ++ EF Sbjct: 110 LRWKQTDEE------IDEIIKAADVDGDGQINYREF 139 Score = 29.9 bits (64), Expect = 0.81 Identities = 17/59 (28%), Positives = 27/59 (45%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 FR+FD + +G I E ++ DE++ + DVD DG I E ++ A Sbjct: 87 FRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAADVDGDGQINYREFARLMMA 145 Score = 29.1 bits (62), Expect = 1.4 Identities = 17/52 (32%), Positives = 22/52 (42%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 F V+D+N DG I EEF + +L D+D DG I E Sbjct: 17 FSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTE 68 >At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calmodulin [Arabidopsis thaliana] GI:16223; nearly identical to SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 38.3 bits (85), Expect = 0.002 Identities = 23/83 (27%), Positives = 36/83 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + FRVFD++ +G I E ++ DE++ Sbjct: 66 FPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 R DVD DG I +E I+ A Sbjct: 126 IREADVDGDGQINYEEFVKIMMA 148 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F +FD++ DG I +E + + + +L D D +G I E N++ Sbjct: 17 FSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLM 73 >At5g57190.1 68418.m07144 phosphatidylserine decarboxylase, putative similar to SP|P53037 Phosphatidylserine decarboxylase proenzyme 2 precursor (EC 4.1.1.65) {Saccharomyces cerevisiae}; contains Pfam profile PF02666: phosphatidylserine decarboxylase Length = 615 Score = 37.5 bits (83), Expect = 0.004 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 6/62 (9%) Query: 31 KFASLVFRVFDENNDGSIEFEEF---IRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRD 87 +FA + + D N DG + F EF I+A N E+L F+ D++ DG +T D Sbjct: 157 RFAKRILSIVDYNEDGQLSFSEFSDLIKAFGNLVAANKKEEL---FKAADLNGDGVVTID 213 Query: 88 EM 89 E+ Sbjct: 214 EL 215 >At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-related protein 2, touch-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 161 Score = 37.5 bits (83), Expect = 0.004 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 6/56 (10%) Query: 36 VFRVFDENNDGSI---EFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 VF+ FD+N DG I E +E IRALS T+ E+ + +D+D +G+I DE Sbjct: 21 VFQRFDKNGDGKISVDELKEVIRALSPTAS---PEETVTMMKQFDLDGNGFIDLDE 73 Score = 36.7 bits (81), Expect = 0.007 Identities = 19/81 (23%), Positives = 43/81 (53%), Gaps = 6/81 (7%) Query: 18 KIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEK-----LHWA 72 ++ + P P + +++ + FD + +G I+ +EF+ + G + + L A Sbjct: 40 EVIRALSPTASPEETVTMM-KQFDLDGNGFIDLDEFVALFQIGIGGGGNNRNDVSDLKEA 98 Query: 73 FRLYDVDNDGYITRDEMYNIV 93 F LYD+D +G I+ E+++++ Sbjct: 99 FELYDLDGNGRISAKELHSVM 119 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Query: 63 GNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVD 117 G++D+ + F+ +D + DG I+ DE+ ++ A+ T PE+ T K+ D Sbjct: 13 GSMDD-IKKVFQRFDKNGDGKISVDELKEVIRAL----SPTASPEETVTMMKQFD 62 Score = 27.5 bits (58), Expect = 4.3 Identities = 9/27 (33%), Positives = 19/27 (70%) Query: 116 VDKIFDQMDKNHDDRLTLEEFREGSKA 142 + K+F + DKN D +++++E +E +A Sbjct: 18 IKKVFQRFDKNGDGKISVDELKEVIRA 44 >At5g08580.1 68418.m01021 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 391 Score = 37.5 bits (83), Expect = 0.004 Identities = 34/113 (30%), Positives = 48/113 (42%), Gaps = 24/113 (21%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLH---------------WAFRLYDVDNDGYIT 85 D + DG I FEEF L T R N +E H F D ++DGY++ Sbjct: 262 DSDKDGKISFEEFFHGLFDTVR-NYEEDNHNSTHPYHDLPEGPAKQLFSQLDKNDDGYLS 320 Query: 86 RDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 E+ I+ I+ P + +++ D I Q D + D RLTL E E Sbjct: 321 DVELLPIISKIH--------PTEHYYAKQQADYIISQADSDKDRRLTLAEMIE 365 >At5g44090.1 68418.m05394 calcium-binding EF hand family protein, putative / protein phosphatase 2A 62 kDa B'' regulatory subunit, putative contains Pfam profile: PF00036 EF hand; identical to cDNA protein phosphatase 2A 62 kDa B'' regulatory subunit GI:5533378 Length = 538 Score = 37.1 bits (82), Expect = 0.005 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 5/118 (4%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM-YNI 92 S V R F +G + +E+F + + + L + F+ D+D DG IT +EM + Sbjct: 360 SQVPRKFTSKVEGKMSYEDFAYFILAEEDKSSEPSLEYWFKCIDLDGDGVITPNEMQFFY 419 Query: 93 VDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 + +++M T +P + + +IFD + ++ +TL++ + SK I L Sbjct: 420 EEQLHRMECITQEPV---LFEDILCQIFDMIKPEKENCITLQDLK-ASKLSGNIFNIL 473 >At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDPK9) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836938|gb|AAA67653; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 490 Score = 37.1 bits (82), Expect = 0.005 Identities = 18/54 (33%), Positives = 30/54 (55%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 + R D + G+I++ EF+ A ++ +E L AF +D D GYIT +E+ Sbjct: 367 LLRAADVDESGTIDYGEFLAATIHLNKLEREENLVAAFSFFDKDASGYITIEEL 420 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/53 (26%), Positives = 25/53 (47%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 +F++ D + G+I FEE ++ ++ ++ R DVD G I E Sbjct: 331 LFKMIDTDKSGTITFEELKDSMRRVGSELMESEIQELLRAADVDESGTIDYGE 383 >At4g26470.1 68417.m03808 calcium-binding EF hand family protein low similarity to SP|P06787 Calmodulin {Saccharomyces cerevisiae}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 248 Score = 37.1 bits (82), Expect = 0.005 Identities = 32/146 (21%), Positives = 68/146 (46%), Gaps = 10/146 (6%) Query: 14 QGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAF 73 + F I +F D + +F+ FDE+++GSI+ E + +E+++ F Sbjct: 40 KSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLF 99 Query: 74 RLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKR----VDKIFDQMDKNHDD 129 + D++ D IT E ++ +Y + +D +T QK+ + K+ + D Sbjct: 100 KACDINEDMGITFTEFIVLLCLVYLL------KDDSSTLQKKWTMGMPKLEPTFETLVDT 153 Query: 130 RLTLEEFREGSKADPRIVQALSLGGD 155 + L+E ++G + +V+A+ G+ Sbjct: 154 FVFLDENKDGYVSREEMVRAIDESGE 179 >At3g51850.1 68416.m05686 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 528 Score = 36.7 bits (81), Expect = 0.007 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 11/102 (10%) Query: 35 LVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVD 94 ++ D G++++ EF+ + DE L AF +D D +GYI E + D Sbjct: 398 MLIEAVDTKGKGTLDYGEFVAVSLHLQKVANDEHLRKAFSYFDKDGNGYILPQE---LCD 454 Query: 95 AIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 A+ + G D+ + IF ++D + D R++ EEF Sbjct: 455 ALKEDGG------DDCVDV--ANDIFQEVDTDKDGRISYEEF 488 >At3g03410.1 68416.m00339 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 131 Score = 36.7 bits (81), Expect = 0.007 Identities = 20/68 (29%), Positives = 31/68 (45%) Query: 33 ASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNI 92 A VF FD+N DG + +EF S E + F DVD +G + DE + Sbjct: 3 AKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSC 62 Query: 93 VDAIYQMV 100 ++ + + V Sbjct: 63 IEKMLKEV 70 Score = 31.9 bits (69), Expect = 0.20 Identities = 11/21 (52%), Positives = 18/21 (85%) Query: 118 KIFDQMDKNHDDRLTLEEFRE 138 ++F++ DKN D +L+L+EFRE Sbjct: 5 RVFEKFDKNKDGKLSLDEFRE 25 Score = 30.3 bits (65), Expect = 0.61 Identities = 19/63 (30%), Positives = 26/63 (41%) Query: 31 KFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 K VF D + DG I E ++ + +E R DVD DGY+ DE Sbjct: 65 KMLKEVFVFCDVDGDGKIPASESYVTMTSLGKKFTEETSAEKVRAADVDGDGYLNFDEFM 124 Query: 91 NIV 93 +V Sbjct: 125 ALV 127 >At1g76650.1 68414.m08919 calcium-binding EF hand family protein similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 177 Score = 36.3 bits (80), Expect = 0.009 Identities = 20/66 (30%), Positives = 29/66 (43%) Query: 28 DPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRD 87 D ++ VF D N DG I EE ++ DE+ A RL D D DG + + Sbjct: 39 DKNRELEAVFSYMDANRDGRISPEELQKSFMTLGEQLSDEEAVAAVRLSDTDGDGMLDFE 98 Query: 88 EMYNIV 93 E ++ Sbjct: 99 EFSQLI 104 Score = 36.3 bits (80), Expect = 0.009 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Query: 18 KIYKQFFPQGDP--SKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRL 75 ++ K F G+ + A R+ D + DG ++FEEF + + V +L AFRL Sbjct: 63 ELQKSFMTLGEQLSDEEAVAAVRLSDTDGDGMLDFEEFSQLIKVDDEEEKKMELKGAFRL 122 Query: 76 YDVDNDGYIT 85 Y + + IT Sbjct: 123 YIAEGEDCIT 132 >At1g76640.1 68414.m08918 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum] Length = 159 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/53 (33%), Positives = 25/53 (47%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 VF D N DG I EE ++ DE+ A +L D+D DG + +E Sbjct: 26 VFAYMDANRDGRISAEELKKSFKTLGEQMSDEEAEAAVKLSDIDGDGMLDINE 78 Score = 26.6 bits (56), Expect = 7.5 Identities = 11/43 (25%), Positives = 21/43 (48%) Query: 11 CVFQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEF 53 C+ G +K+ + + ++ + FD N DG + F+EF Sbjct: 112 CITPGSLKMMLMKLGESRTTDDCKVMIQAFDLNADGVLSFDEF 154 >At1g54450.1 68414.m06211 calcium-binding EF-hand family protein contains Pfam profile: PF00036 EF hand Length = 535 Score = 36.3 bits (80), Expect = 0.009 Identities = 27/123 (21%), Positives = 59/123 (47%), Gaps = 12/123 (9%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNL--DEKLHWAFRLYDVDNDGYITR 86 PS F++ +F+ D NN G ++ E+FI +GN+ E F + + Y+ + Sbjct: 175 PSFFSTSIFKKVDTNNTGFVKREDFI---DYWVKGNMLTKEITSQVFTILKQPDHNYLVQ 231 Query: 87 DEMYNIVDAI------YQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGS 140 D+ ++ + + + TP+ +D + + +I+ ++++ + LTL E + G+ Sbjct: 232 DDFKPVLQELLATHPGLEFLQGTPEFQDRYA-ETVIYRIYYYINRSGNGHLTLRELKRGN 290 Query: 141 KAD 143 D Sbjct: 291 LVD 293 Score = 33.5 bits (73), Expect = 0.066 Identities = 15/56 (26%), Positives = 30/56 (53%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 S V R F +G + +E+F+ + + + L + F+ D+D +G +TR+E+ Sbjct: 357 SQVPRKFTSKTEGKMGYEDFVYFILAEEDKSSEPSLEYWFKCIDLDANGVLTRNEL 412 >At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to calmodulin 8 GI:5825600 from [Arabidopsis thaliana] Length = 151 Score = 35.9 bits (79), Expect = 0.012 Identities = 18/81 (22%), Positives = 35/81 (43%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + + D + F+VFD++ +G I E + DE++ Sbjct: 67 FAEFLNLMAKKLQESDAEEELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQM 126 Query: 73 FRLYDVDNDGYITRDEMYNIV 93 + D+D DG + DE ++ Sbjct: 127 IKEADLDGDGQVNYDEFVKMM 147 Score = 33.5 bits (73), Expect = 0.066 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 8/90 (8%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F +FD++ DG I EE + + +++LH D D++G I E N Sbjct: 18 FCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTIEFAEFLN----- 72 Query: 97 YQMVGQTPQPEDENTPQKRVDKIFDQMDKN 126 ++ + Q D K K+FD+ D+N Sbjct: 73 --LMAKKLQESDAEEELKEAFKVFDK-DQN 99 Score = 27.9 bits (59), Expect = 3.3 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 11/65 (16%) Query: 72 AFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRL 131 AF L+D D DG IT +E+ ++ ++ D+N ++ + I ++D + + + Sbjct: 17 AFCLFDKDGDGCITVEELATVIRSL-----------DQNPTEQELHDIITEIDSDSNGTI 65 Query: 132 TLEEF 136 EF Sbjct: 66 EFAEF 70 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 35.5 bits (78), Expect = 0.016 Identities = 25/108 (23%), Positives = 55/108 (50%), Gaps = 16/108 (14%) Query: 31 KFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMY 90 ++AS +V D N DG ++++EF R + + +L+ F+ D++++G I E++ Sbjct: 71 RYASDFLKVCDSNRDGRVDYQEFRRYMDAK-----ELELYKIFQAIDIEHNGDICPAELW 125 Query: 91 NIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 +D + +DE + + +DK+++ +T EE+R+ Sbjct: 126 EALDKAGIKI------KDE-----ELASFMEHVDKDNNGIITFEEWRD 162 >At5g49480.1 68418.m06123 sodium-inducible calcium-binding protein (ACP1) / sodium-responsive calcium-binding protein (ACP1) identical to NaCl-inducible Ca2+-binding protein GI:2352828 from [Arabidopsis thaliana] Length = 160 Score = 35.5 bits (78), Expect = 0.016 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Query: 39 VFDENNDGSIEFEEFIRALSVT-----SRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 V D N DG +EF+EF + L T G D + F++ D D DG ++ ++ + + Sbjct: 63 VADANKDGFVEFDEFEKVLETTPFSRSGNGGDDGLMKDVFKVMDKDGDGRLSYGDLKSYM 122 Query: 94 DA 95 D+ Sbjct: 123 DS 124 Score = 29.9 bits (64), Expect = 0.81 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 11/89 (12%) Query: 56 ALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKR 115 A+ +T+ N AF + D D+DG I+ D++ A Y + P EN + Sbjct: 8 AIPITTTAN--PNFRPAFEIIDTDHDGKISSDDL----RAFYAGI-----PSGENNDETM 56 Query: 116 VDKIFDQMDKNHDDRLTLEEFREGSKADP 144 + + D N D + +EF + + P Sbjct: 57 IGTMISVADANKDGFVEFDEFEKVLETTP 85 >At5g44460.1 68418.m05448 calcium-binding protein, putative similar to SP|Q09011 Calcium-binding protein CAST {Solanum tuberosum}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 181 Score = 35.5 bits (78), Expect = 0.016 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 9/75 (12%) Query: 63 GNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQ 122 G+ + L AF ++D D DG+I+ E+ ++ + +G E E +V+K+ Sbjct: 106 GSPESDLEEAFNVFDEDGDGFISAVELQKVL----KKLGLPEAGEIE-----QVEKMIVS 156 Query: 123 MDKNHDDRLTLEEFR 137 +D NHD R+ EF+ Sbjct: 157 VDSNHDGRVDFFEFK 171 Score = 31.5 bits (68), Expect = 0.26 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Query: 27 GDPSKFASLVFRVFDENNDG---SIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGY 83 G P F VFDE+ DG ++E ++ ++ L + G + E++ D ++DG Sbjct: 106 GSPESDLEEAFNVFDEDGDGFISAVELQKVLKKLGLPEAGEI-EQVEKMIVSVDSNHDGR 164 Query: 84 ITRDEMYNIVDAI 96 + E N++ + Sbjct: 165 VDFFEFKNMMQTV 177 Score = 31.1 bits (67), Expect = 0.35 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 36 VFRVFDENNDGSIEFEEFIRALS 58 VF +FD+NNDG I EE +ALS Sbjct: 32 VFDLFDKNNDGFITVEELSQALS 54 Score = 29.5 bits (63), Expect = 1.1 Identities = 11/22 (50%), Positives = 17/22 (77%) Query: 68 KLHWAFRLYDVDNDGYITRDEM 89 +LH F L+D +NDG+IT +E+ Sbjct: 28 RLHRVFDLFDKNNDGFITVEEL 49 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/24 (41%), Positives = 17/24 (70%) Query: 115 RVDKIFDQMDKNHDDRLTLEEFRE 138 R+ ++FD DKN+D +T+EE + Sbjct: 28 RLHRVFDLFDKNNDGFITVEELSQ 51 >At3g25600.1 68416.m03187 calmodulin, putative similar to calmodulin GI:239841 from [Paramecium tetraurelia] Length = 161 Score = 35.5 bits (78), Expect = 0.016 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNL---DEKLHWAFRLYDVDNDGYITRDEM 89 SL+ D N +GS+EF+E + A+ + E+L FR +D D +G IT E+ Sbjct: 50 SLLLNQIDRNGNGSVEFDELVVAILPDINEEVLINQEQLMEVFRSFDRDGNGSITAAEL 108 >At3g24110.1 68416.m03027 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand, similar to calcium-modulated proteins Length = 229 Score = 35.5 bits (78), Expect = 0.016 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 VF +D + +G+I+ EE + L DE++ + DVD I +E ++ Sbjct: 61 VFESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCDVDGSKGIQFNEFIVLLCL 120 Query: 96 IYQMVGQTPQPEDENTPQ--KRVDKIFD 121 IY + + + E+ K V+ IFD Sbjct: 121 IYLLAKPSSESSTESREMGPKLVESIFD 148 >At1g32250.1 68414.m03967 calmodulin, putative similar to calmodulin GB:M59770 GI:160127 from (Plasmodium falciparum); contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 166 Score = 35.5 bits (78), Expect = 0.016 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 8/68 (11%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFI-----RALSVTSRGN--LDEKLHWAFRLYDVDND 81 P +F +L+ + D ++G +EF EF+ LS R +E+L FR++D D + Sbjct: 50 PDQFETLIDKA-DTKSNGLVEFPEFVALVSPELLSPAKRTTPYTEEQLLRLFRIFDTDGN 108 Query: 82 GYITRDEM 89 G+IT E+ Sbjct: 109 GFITAAEL 116 Score = 26.2 bits (55), Expect = 10.0 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Query: 36 VFRVFDENNDGS---IEFEEFIRALSV 59 +FR FD N DGS +E +RAL V Sbjct: 20 IFRSFDRNKDGSLTQLELGSLLRALGV 46 >At1g73630.1 68414.m08524 calcium-binding protein, putative similar to calcium binding protein GI:14589311 from [Sesbania rostrata]; contains Pfam profile: PF00036 EF hand (4 copies) Length = 163 Score = 35.1 bits (77), Expect = 0.021 Identities = 18/57 (31%), Positives = 25/57 (43%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNI 92 VF FD N DG I E +E+L+ D+D DG+I ++E I Sbjct: 24 VFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDIDCDGFINQEEFATI 80 >At4g25970.1 68417.m03737 phosphatidylserine decarboxylase, putative similar to SP|P53037 Phosphatidylserine decarboxylase proenzyme 2 precursor (EC 4.1.1.65) {Saccharomyces cerevisiae}; contains Pfam profile PF02666: phosphatidylserine decarboxylase Length = 635 Score = 34.7 bits (76), Expect = 0.028 Identities = 16/58 (27%), Positives = 27/58 (46%) Query: 32 FASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 FA + + D + DG + F EF ++ K F+ D++ DG +T DE+ Sbjct: 179 FAKRILSIVDYDEDGKLSFSEFSDLMNAFGNVVAANKKEELFKAADLNGDGVVTIDEL 236 >At5g42380.1 68418.m05160 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum] Length = 185 Score = 34.3 bits (75), Expect = 0.038 Identities = 17/59 (28%), Positives = 28/59 (47%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVD 94 VF D N+DG I EE +S+ ++ + DVD DG+I +E +++ Sbjct: 53 VFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKLME 111 Score = 27.9 bits (59), Expect = 3.3 Identities = 9/20 (45%), Positives = 16/20 (80%) Query: 35 LVFRVFDENNDGSIEFEEFI 54 ++ R FD+N+DG + F+EF+ Sbjct: 162 VMIRGFDQNDDGVLSFDEFV 181 >At3g22930.1 68416.m02889 calmodulin, putative strong similarity to calmodulin 8 GI:5825600 from [Arabidopsis thaliana]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 173 Score = 34.3 bits (75), Expect = 0.038 Identities = 18/81 (22%), Positives = 34/81 (41%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ + + D + F+VFD++ +G I E + DE++ Sbjct: 89 FSEFLNLMANQLQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQM 148 Query: 73 FRLYDVDNDGYITRDEMYNIV 93 + D+D DG + DE ++ Sbjct: 149 IKEADLDGDGQVNYDEFVRMM 169 Score = 29.9 bits (64), Expect = 0.81 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 8/90 (8%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 F +FD++ DG I +E + + +++L D D +G I E N+ Sbjct: 40 FCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFSEFLNL---- 95 Query: 97 YQMVGQTPQPEDENTPQKRVDKIFDQMDKN 126 M Q Q D + K K+FD+ D+N Sbjct: 96 --MANQL-QETDADEELKEAFKVFDK-DQN 121 Score = 29.5 bits (63), Expect = 1.1 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 11/65 (16%) Query: 72 AFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRL 131 AF L+D D DG IT DE+ ++ ++ D+N ++ + + ++D + + + Sbjct: 39 AFCLFDKDGDGCITADELATVIRSL-----------DQNPTEQELQDMITEIDSDGNGTI 87 Query: 132 TLEEF 136 EF Sbjct: 88 EFSEF 92 >At1g73440.1 68414.m08501 calmodulin-related low similarity to calmodulin 8 [Arabidopsis thaliana] GI:5825600; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00036: EF hand Length = 254 Score = 34.3 bits (75), Expect = 0.038 Identities = 19/67 (28%), Positives = 30/67 (44%) Query: 35 LVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVD 94 + F FDE G I + + +V +E+L R +D+D DG ++ DE IV Sbjct: 187 MYFCQFDEGGKGFITLRDVAKMATVHDFTWTEEELQDMIRCFDMDKDGKLSLDEFRKIVS 246 Query: 95 AIYQMVG 101 + G Sbjct: 247 RCRMLKG 253 >At5g28900.1 68418.m03562 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 536 Score = 33.9 bits (74), Expect = 0.050 Identities = 25/117 (21%), Positives = 52/117 (44%), Gaps = 3/117 (2%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 S V R F +G + +E+F+ + + L + F+ D+D +G ITR+EM Sbjct: 357 SQVARKFTNKVEGKMGYEDFVYFILAEEDKSSVPSLEYWFKCIDLDANGIITRNEMQFFY 416 Query: 94 DAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 + Q+ ++ + + ++ D + ++ +TL + + GSK + L Sbjct: 417 EE--QLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLK-GSKLSGNVFNIL 470 Score = 31.1 bits (67), Expect = 0.35 Identities = 25/121 (20%), Positives = 55/121 (45%), Gaps = 8/121 (6%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 PS F++ +FR D NN G + + FI V + + F++ + +I +D+ Sbjct: 175 PSFFSTSLFRKIDLNNTGFVTRDAFI-DFWVNGNMLIMDTTTQIFKILKQKDQSFIVKDD 233 Query: 89 MYNIVDAI------YQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKA 142 ++ + + + TP+ + E + +IF ++++ + R+T E + G+ Sbjct: 234 FKPLLKELLATHPGLEFLQSTPEFQ-ERYAETVTYRIFYYINRSGNGRITFRELKRGNLI 292 Query: 143 D 143 D Sbjct: 293 D 293 >At5g28850.2 68418.m03550 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 536 Score = 33.9 bits (74), Expect = 0.050 Identities = 25/117 (21%), Positives = 52/117 (44%), Gaps = 3/117 (2%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 S V R F +G + +E+F+ + + L + F+ D+D +G ITR+EM Sbjct: 357 SQVARKFTSKVEGKMGYEDFVYFILAEEDKSSVPSLEYWFKCIDLDANGIITRNEMQFFY 416 Query: 94 DAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 + Q+ ++ + + ++ D + ++ +TL + + GSK + L Sbjct: 417 EE--QLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLK-GSKLSGNVFNIL 470 Score = 31.1 bits (67), Expect = 0.35 Identities = 25/121 (20%), Positives = 55/121 (45%), Gaps = 8/121 (6%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 PS F++ +FR D NN G + + FI V + + F++ + +I +D+ Sbjct: 175 PSFFSTSLFRKIDLNNTGFVTRDAFI-DFWVNGNMLIMDTTTQIFKILKQKDQSFIVKDD 233 Query: 89 MYNIVDAI------YQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKA 142 ++ + + + TP+ + E + +IF ++++ + R+T E + G+ Sbjct: 234 FKPLLKELLATHPGLEFLQSTPEFQ-ERYAETVTYRIFYYINRSGNGRITFRELKRGNLI 292 Query: 143 D 143 D Sbjct: 293 D 293 >At5g28850.1 68418.m03549 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 324 Score = 33.9 bits (74), Expect = 0.050 Identities = 25/117 (21%), Positives = 52/117 (44%), Gaps = 3/117 (2%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 S V R F +G + +E+F+ + + L + F+ D+D +G ITR+EM Sbjct: 145 SQVARKFTSKVEGKMGYEDFVYFILAEEDKSSVPSLEYWFKCIDLDANGIITRNEMQFFY 204 Query: 94 DAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 + Q+ ++ + + ++ D + ++ +TL + + GSK + L Sbjct: 205 EE--QLHRMECMAQEAVLFEDILCQMIDMIGPENESHITLHDLK-GSKLSGNVFNIL 258 >At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 324 Score = 33.9 bits (74), Expect = 0.050 Identities = 32/108 (29%), Positives = 43/108 (39%), Gaps = 8/108 (7%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 FR+FD+N DGSI +E + L D+D DG I E + V A Sbjct: 17 FRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGTIDFPE-FLCVMAK 75 Query: 97 YQMVGQTPQPEDENTPQKRVD-------KIFDQMDKNHDDRLTLEEFR 137 Q Q P+ + K D + F DKN D +T +E R Sbjct: 76 NQGHDQAPRHTKKTMADKLTDDQITEYRESFRLFDKNGDGSITKKELR 123 Score = 33.9 bits (74), Expect = 0.050 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 9/109 (8%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 FR+FD+N DGSI +E + + L D+D DG I E ++ A Sbjct: 106 FRLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLDGDGTIDFPEFLYLM-AK 164 Query: 97 YQMVGQTPQPEDENTPQKRV--DKI------FDQMDKNHDDRLTLEEFR 137 Q Q P+ + ++ D+I F DKN D +T+ E R Sbjct: 165 NQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVNELR 213 >At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDPK1) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 545 Score = 33.9 bits (74), Expect = 0.050 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 13/116 (11%) Query: 27 GDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITR 86 G+P ++ V D + +G +++ EF+ + + DE AF +D D YI Sbjct: 401 GEPE--IKMLMEVADVDGNGFLDYGEFVAVIIHLQKIENDELFKLAFMFFDKDGSTYIEL 458 Query: 87 DEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKA 142 DE+ +A+ +G +P+ + I ++D + D R+ +EF KA Sbjct: 459 DELR---EALADELG---EPD-----ASVLSDIMREVDTDKDGRINYDEFVTMMKA 503 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 +F + D++ DG I + E L + ++ + DVD +G++ E ++ Sbjct: 372 MFSLMDDDKDGKITYPELKAGLQKVGSQLGEPEIKMLMEVADVDGNGFLDYGEFVAVI 429 >At1g18210.2 68414.m02267 calcium-binding protein, putative similar to SP|Q9M7R0 Calcium-binding allergen Ole e 8 (PCA18/PCA23) {Olea europaea}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 170 Score = 33.9 bits (74), Expect = 0.050 Identities = 18/53 (33%), Positives = 21/53 (39%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 VF FD N DG I E + +L+ D D DGYI DE Sbjct: 27 VFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDE 79 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 103 TPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEE 135 TP D P++ + K+FDQ D N D ++++ E Sbjct: 12 TPATVDMANPEE-LKKVFDQFDSNGDGKISVLE 43 >At1g18210.1 68414.m02266 calcium-binding protein, putative similar to SP|Q9M7R0 Calcium-binding allergen Ole e 8 (PCA18/PCA23) {Olea europaea}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 170 Score = 33.9 bits (74), Expect = 0.050 Identities = 18/53 (33%), Positives = 21/53 (39%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 VF FD N DG I E + +L+ D D DGYI DE Sbjct: 27 VFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDE 79 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 103 TPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEE 135 TP D P++ + K+FDQ D N D ++++ E Sbjct: 12 TPATVDMANPEE-LKKVFDQFDSNGDGKISVLE 43 >At1g03960.2 68414.m00382 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 389 Score = 33.9 bits (74), Expect = 0.050 Identities = 25/118 (21%), Positives = 56/118 (47%), Gaps = 5/118 (4%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM-YNI 92 S + R F +G + +E+F+ + + + L + F+ D+D +G IT +EM + Sbjct: 211 SQIPRKFTSKVEGKMSYEDFVYFILAEEDKSSEPSLEYWFKCVDLDGNGVITSNEMQFFF 270 Query: 93 VDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 + +++M T ++ + +I D + ++ +TL++ + GSK + L Sbjct: 271 EEQLHRMECIT---QEAVLFSDILCQIIDMIGPEKENCITLQDLK-GSKLSANVFNIL 324 >At1g03960.1 68414.m00381 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 529 Score = 33.9 bits (74), Expect = 0.050 Identities = 25/118 (21%), Positives = 56/118 (47%), Gaps = 5/118 (4%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM-YNI 92 S + R F +G + +E+F+ + + + L + F+ D+D +G IT +EM + Sbjct: 351 SQIPRKFTSKVEGKMSYEDFVYFILAEEDKSSEPSLEYWFKCVDLDGNGVITSNEMQFFF 410 Query: 93 VDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 150 + +++M T ++ + +I D + ++ +TL++ + GSK + L Sbjct: 411 EEQLHRMECIT---QEAVLFSDILCQIIDMIGPEKENCITLQDLK-GSKLSANVFNIL 464 >At3g10190.1 68416.m01220 calmodulin, putative similar to calmodulin NtCaM13 [Nicotiana tabacum] GI:14625425, calmodulin GB:AAA34015 [Glycine max]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 209 Score = 33.5 bits (73), Expect = 0.066 Identities = 16/63 (25%), Positives = 28/63 (44%) Query: 34 SLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 +++ + D + DG+I EE + +L F +D D DG I+ DE+ + Sbjct: 109 NVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISADELLRVF 168 Query: 94 DAI 96 I Sbjct: 169 STI 171 Score = 30.3 bits (65), Expect = 0.61 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Query: 72 AFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDE-NTPQKRVD 117 AF+L D DNDG ++R ++ +++ +G P E+E N K VD Sbjct: 74 AFKLIDRDNDGAVSRHDL----ESLLSRLGPDPLTEEEINVMLKEVD 116 >At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to calmodulin 9 GI:5825602 from [Arabidopsis thaliana]; contains Pfam profile PF00036: EF hand Length = 151 Score = 33.1 bits (72), Expect = 0.087 Identities = 24/83 (28%), Positives = 34/83 (40%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F F+ I Q Q S VFRVFD + DG I E + E+ Sbjct: 66 FDDFLYIMAQNTSQESASDELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHM 125 Query: 73 FRLYDVDNDGYITRDEMYNIVDA 95 R D+D DG+++ E ++ A Sbjct: 126 VREADLDGDGFLSFHEFSKMMIA 148 Score = 29.9 bits (64), Expect = 0.81 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Query: 67 EKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKN 126 ++ + AF L D D+DG+IT++++ ++ + +G+ P+ E VD IF Sbjct: 11 QEFYEAFCLIDKDSDGFITKEKLTKVM----KSMGKNPKAEQLQQMMSDVD-IFGNGGIT 65 Query: 127 HDDRL 131 DD L Sbjct: 66 FDDFL 70 >At2g15680.1 68415.m01795 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 187 Score = 33.1 bits (72), Expect = 0.087 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 4/87 (4%) Query: 10 FCVFQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRAL-SVTSRGNLDEK 68 F F+ FI YK+ G S F FD N DG I EE + L + R +L E Sbjct: 101 FIDFREFIDAYKR--SGGIRSSDIRNSFWTFDLNGDGKISAEEVMSVLWKLGERCSL-ED 157 Query: 69 LHWAFRLYDVDNDGYITRDEMYNIVDA 95 + R D D DG + +E ++ + Sbjct: 158 CNRMVRAVDADGDGLVNMEEFIKMMSS 184 Score = 30.3 bits (65), Expect = 0.61 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 12/100 (12%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 VF FD + DG I E+ L + E + F+ D+D DG+I + +DA Sbjct: 54 VFSRFDLDKDGKISQTEYKVVLRALGQERAIEDVPKIFKAVDLDGDGFI---DFREFIDA 110 Query: 96 IYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEE 135 Y+ G + N+ F D N D +++ EE Sbjct: 111 -YKRSGGIRSSDIRNS--------FWTFDLNGDGKISAEE 141 >At3g47480.1 68416.m05163 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 183 Score = 32.7 bits (71), Expect = 0.11 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDE-KLHWAFRLYDVDNDGYITRDEMYNIVD 94 FR+FDEN DG I+ E LS+ + + ++YD + DG I E +++ Sbjct: 121 FRLFDENQDGFIDENELKHVLSLLGYDECTKMECRKMVKVYDENRDGKIDFYEFVKLIE 179 Score = 27.5 bits (58), Expect = 4.3 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 10/65 (15%) Query: 72 AFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRL 131 AFRL+D + DG+I +E+ +++ ++G DE T + K+ D+N D ++ Sbjct: 120 AFRLFDENQDGFIDENELKHVL----SLLGY-----DECT-KMECRKMVKVYDENRDGKI 169 Query: 132 TLEEF 136 EF Sbjct: 170 DFYEF 174 >At2g44310.1 68415.m05513 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 142 Score = 32.7 bits (71), Expect = 0.11 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 9/85 (10%) Query: 73 FRLYDVDNDGYITRDEMYNIVDAIYQMVGQ----TPQPEDENTPQKRVDKIFDQMDKNHD 128 F D++ DG ++R E+ +++ + P+DE T D IF++ D + Sbjct: 29 FAALDLNKDGVLSRSELRKAFESMRLLESHFGVDVVTPQDELT--NLYDSIFEKFDTDQS 86 Query: 129 DRLTLEEFREGSKADPRIVQALSLG 153 + LEEFR K +IV A++ G Sbjct: 87 GSVDLEEFRSEMK---KIVLAIADG 108 Score = 27.1 bits (57), Expect = 5.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 25 PQGDPSKFASLVFRVFDENNDGSIEFEEF 53 PQ + + +F FD + GS++ EEF Sbjct: 66 PQDELTNLYDSIFEKFDTDQSGSVDLEEF 94 >At1g24620.1 68414.m03097 polcalcin, putative / calcium-binding pollen allergen, putative similar to polcalcin Jun o 2 (calcium-binding pollen allergen Jun o 2) SP:O64943 from [Juniperus oxycedrus] Length = 186 Score = 32.3 bits (70), Expect = 0.15 Identities = 18/57 (31%), Positives = 26/57 (45%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNI 92 VF+ FD N DG I +E ++ +E+L A D DGYI +E + Sbjct: 41 VFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEIDRKGDGYINFEEFVEL 97 Score = 28.7 bits (61), Expect = 1.9 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 11/71 (15%) Query: 68 KLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNH 127 +L F+ +DV+ DG I+ E+ AI +G P++ ++K ++D+ Sbjct: 37 ELEAVFKKFDVNGDGKISSKEL----GAIMTSLG-------HEVPEEELEKAITEIDRKG 85 Query: 128 DDRLTLEEFRE 138 D + EEF E Sbjct: 86 DGYINFEEFVE 96 >At1g21550.1 68414.m02695 calcium-binding protein, putative contains similarity to calcium-binding protein GB:CAB63264 GI:6580549 from [Lotus japonicus] Length = 155 Score = 32.3 bits (70), Expect = 0.15 Identities = 11/31 (35%), Positives = 23/31 (74%) Query: 66 DEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 DE + AF ++DV+ DGYI+ +E+ ++++ + Sbjct: 87 DEAIARAFNVFDVNGDGYISAEELRDVLERL 117 Score = 30.7 bits (66), Expect = 0.46 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 6/70 (8%) Query: 28 DPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHW----AFRLYDVDNDGY 83 D + + F VFD N DG I EE L G +E W R++D + DG+ Sbjct: 85 DNDEAIARAFNVFDVNGDGYISAEELRDVLE--RLGFEEEAKAWDCGRMIRVHDKNLDGF 142 Query: 84 ITRDEMYNIV 93 + +E N++ Sbjct: 143 VDFEEFKNMI 152 >At4g20780.1 68417.m03017 calcium-binding protein, putative similar to SP|Q09011 Calcium-binding protein CAST {Solanum tuberosum}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 191 Score = 31.9 bits (69), Expect = 0.20 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 9/78 (11%) Query: 60 TSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKI 119 +S + L AF+++D + DG+I+ E+ ++ + P E +RV+K+ Sbjct: 112 SSAAENESDLAEAFKVFDENGDGFISARELQTVLKKL-----GLP----EGGEMERVEKM 162 Query: 120 FDQMDKNHDDRLTLEEFR 137 +D+N D R+ EF+ Sbjct: 163 IVSVDRNQDGRVDFFEFK 180 Score = 28.7 bits (61), Expect = 1.9 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Query: 37 FRVFDENNDGSI---EFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 F+VFDEN DG I E + ++ L + G + E++ D + DG + E N++ Sbjct: 125 FKVFDENGDGFISARELQTVLKKLGLPEGGEM-ERVEKMIVSVDRNQDGRVDFFEFKNMM 183 Query: 94 DAI 96 + Sbjct: 184 RTV 186 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 115 RVDKIFDQMDKNHDDRLTLEEFRE 138 R+ +IFD DKN D +T+EE + Sbjct: 29 RLQRIFDLFDKNGDGFITVEELSQ 52 Score = 27.1 bits (57), Expect = 5.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 36 VFRVFDENNDGSIEFEEFIRALS 58 +F +FD+N DG I EE +AL+ Sbjct: 33 IFDLFDKNGDGFITVEELSQALT 55 >At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding pollen allergen, putative almost identical to polcalcin Bra r 2/Bra n 2 (calcium-binding pollen allergen Bra r 2/Bra n 2) SP:Q39406 from [Brassica napus] Length = 83 Score = 31.1 bits (67), Expect = 0.35 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNL-DEKLHWAFRLYDVDNDGYITRDEMYNIVD 94 +F+ FD N DG I E AL + G++ E + D D DGYI+ E + Sbjct: 13 IFKKFDANGDGKISAAELGDALK--NLGSVTHEDIKRMMAEIDTDGDGYISYQEFIDFAS 70 Query: 95 A 95 A Sbjct: 71 A 71 >At2g32450.1 68415.m03964 calcium-binding EF hand family protein low similarity to O-linked GlcNAc transferase [Homo sapiens] GI:2266994; contains Pfam profiles PF00036: EF hand, PF00515: TPR Domain Length = 802 Score = 31.1 bits (67), Expect = 0.35 Identities = 14/38 (36%), Positives = 26/38 (68%) Query: 59 VTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 +T+RG+ EK+ F+ +D + DG ++R+EM +V A+ Sbjct: 1 MTTRGSRSEKVKRIFQQFDGNLDGGLSREEMSALVVAV 38 >At5g39670.1 68418.m04804 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 204 Score = 30.7 bits (66), Expect = 0.46 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Query: 18 KIYKQFFPQGDPS-KFASLVFRVFDENNDGSIEFEEFIRALSV--TSRGNLDEKLHWAFR 74 K F + +PS + F VFDEN DG I+ + R L++ +G+ E R Sbjct: 121 KEVSNLFEEKEPSLEEVKQAFDVFDENRDGFIDPIDLQRVLTILGLKQGSNLENCRRMIR 180 Query: 75 LYDVDNDGYI 84 +D DG I Sbjct: 181 SFDGSKDGRI 190 >At5g17480.1 68418.m02051 polcalcin, putative / calcium-binding pollen allergen, putative similar to polcalcin Bra r 2/Bra n 2 (Calcium-binding pollen allergen Bra r 2/Bra n 2) SP:Q39406 from [Brassica napus] Length = 83 Score = 30.7 bits (66), Expect = 0.46 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDA 95 +F+ FD N DG I E AL D+ + D D DG I+ E + A Sbjct: 13 IFKKFDANGDGKISAAELEEALKTLGSVTADDVKRMMAEI-DTDGDGNISYQEFTDFAGA 71 >At3g25280.1 68416.m03157 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 521 Score = 30.7 bits (66), Expect = 0.46 Identities = 18/61 (29%), Positives = 26/61 (42%) Query: 11 CVFQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLH 70 C+F + Y+ P G P K ++V N + S EE +R L + N KL Sbjct: 216 CIFTVGLPFYRFKRPNGSPLKKIAIVIISAARNRNKSDLDEEMMRGLISIYKNNSHNKLK 275 Query: 71 W 71 W Sbjct: 276 W 276 >At3g17470.1 68416.m02232 RelA/SpoT domain-containing protein / calcium-binding EF-hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain, Pfam profile PF04607: Region found in RelA / SpoT proteins Length = 583 Score = 30.7 bits (66), Expect = 0.46 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Query: 36 VFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDE 88 VF + D+N DG I EE + + G E +L D ++DG ++ DE Sbjct: 478 VFCLLDKNGDGMISIEELMEVME--ELGAPGEDAEEMMQLLDSNSDGSLSSDE 528 Score = 26.2 bits (55), Expect = 10.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 27 GDPSKFASLVFRVFDENNDGSIEFEEF 53 G P + A + ++ D N+DGS+ +EF Sbjct: 503 GAPGEDAEEMMQLLDSNSDGSLSSDEF 529 >At3g01830.1 68416.m00126 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum]; Pfam HMM hit: EF hand Length = 146 Score = 30.7 bits (66), Expect = 0.46 Identities = 22/97 (22%), Positives = 49/97 (50%), Gaps = 13/97 (13%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAIYQMV 100 + +D S+E E+F++ + + ++ L AF+LY+ +++G IT + ++ ++ Sbjct: 59 ESTDDKSLELEDFVKLVEEGEEADKEKDLKEAFKLYE-ESEG-ITPKSLKRML----SLL 112 Query: 101 GQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFR 137 G++ +D + + Q D N D + +EFR Sbjct: 113 GESKSLKD-------CEVMISQFDINRDGIINFDEFR 142 >At2g41410.1 68415.m05110 calmodulin, putative identical to SP|P30188 Calmodulin-like protein {Arabidopsis thaliana} Length = 216 Score = 30.7 bits (66), Expect = 0.46 Identities = 21/94 (22%), Positives = 47/94 (50%), Gaps = 5/94 (5%) Query: 26 QGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSR--GNLDEKLHWAFRLYDVDNDGY 83 + +PS F+S + + G+++ +SV + G+ +L AF+L D D+DG Sbjct: 26 RSEPSSFSSNASSSSSDGSYGNLKQGPTATPISVLPQNSGDFYTELVQAFKLIDRDDDGV 85 Query: 84 ITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVD 117 ++R ++ ++ ++ + P E+ + + VD Sbjct: 86 VSRGDLAALIS---RLSHEPPSQEEVSLMLREVD 116 >At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 235 Score = 30.7 bits (66), Expect = 0.46 Identities = 32/109 (29%), Positives = 45/109 (41%), Gaps = 9/109 (8%) Query: 37 FRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 FR+FD+N DGSI +E + L D+D DG I E + V A Sbjct: 17 FRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLDGDGTIDFPE-FLCVMAK 75 Query: 97 YQMVGQTPQPEDENTPQKRV--DKI------FDQMDKNHDDRLTLEEFR 137 Q Q P+ + ++ D+I F DKN D +T+ E R Sbjct: 76 NQGHDQAPRHTKKTMVDYQLTDDQILEFREAFRVFDKNGDGYITVNELR 124 >At3g29000.1 68416.m03624 calcium-binding EF hand family protein similar to calmodulin-like MSS3 GI:9965747 from [Arabidopsis thaliana]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 194 Score = 30.3 bits (65), Expect = 0.61 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Query: 37 FRVFDENNDGSIEFEEFIRALSVT--SRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVD 94 F VFDEN DG I+ E R L++ +G+ + R D + DG I +E ++ Sbjct: 131 FDVFDENKDGFIDAIELQRVLTILGFKQGSYLDNCLVMIRSLDGNKDGKIDFNEFVKFME 190 Query: 95 AIY 97 + Sbjct: 191 TSF 193 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 24 FPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVT 60 F QG ++ R D N DG I+F EF++ + + Sbjct: 156 FKQGSYLDNCLVMIRSLDGNKDGKIDFNEFVKFMETS 192 >At3g18430.1 68416.m02343 calcium-binding EF hand family protein similar to Calcineurin B subunit (Protein phosphatase 2B regulatory subunit) (Calcineurin regulatory subunit) SP:P42322 from [Naegleria gruberi]; contains Pfam profile PF00036: EF hand Length = 175 Score = 30.3 bits (65), Expect = 0.61 Identities = 19/97 (19%), Positives = 39/97 (40%), Gaps = 1/97 (1%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWA 72 F+ F+ F + + L+F+V+D + +G + F++ + L S + ++ Sbjct: 76 FKDFVAFLSAFSAKASLRQKVQLIFKVYDSDCNGKVSFKDIMEVLRDLSGSFMSDEQREQ 135 Query: 73 FRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDE 109 + GY T D + D I P+ + E Sbjct: 136 VLSQVLKESGY-TSDSFLTLEDFIKIFGSSRPEMDVE 171 >At1g05150.1 68414.m00518 calcium-binding EF hand family protein low similarity to O-linked GlcNAc transferase [Homo sapiens] GI:2266994; contains Pfam profiles PF00036: EF hand, PF00515: TPR Domain Length = 808 Score = 30.3 bits (65), Expect = 0.61 Identities = 13/38 (34%), Positives = 25/38 (65%) Query: 59 VTSRGNLDEKLHWAFRLYDVDNDGYITRDEMYNIVDAI 96 + +RG+ EK+ F+ +D ++DG + R+EM +V A+ Sbjct: 1 MATRGSRSEKVKRIFQQFDGNHDGGLNREEMAALVVAV 38 Score = 26.6 bits (56), Expect = 7.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 114 KRVDKIFDQMDKNHDDRLTLEE 135 ++V +IF Q D NHD L EE Sbjct: 9 EKVKRIFQQFDGNHDGGLNREE 30 >At3g44040.1 68416.m04716 expressed protein Length = 144 Score = 29.1 bits (62), Expect = 1.4 Identities = 11/44 (25%), Positives = 23/44 (52%) Query: 105 QPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQ 148 QP+ E + + + + ++ DK + + L +FR + PR V+ Sbjct: 43 QPKSEKSQNRSIGSVVNRPDKQPNPPIRLHDFRRNPQPSPREVE 86 >At4g18160.1 68417.m02698 outward rectifying potassium channel, putative (KCO6) similar to kco1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158; member of the 2 pore, 4 transmembrane (2P/4TM) K+ channel family, PMID:11500563 Length = 436 Score = 28.7 bits (61), Expect = 1.9 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 8/67 (11%) Query: 77 DVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLTLEEF 136 D+DN+G +++ E IY++ + + P + K FD++D+ + ++TL + Sbjct: 378 DIDNNGCVSKAEY-----VIYKLKEMEKITDKDILP---ISKQFDKLDRCSNGKITLLDL 429 Query: 137 REGSKAD 143 EG D Sbjct: 430 LEGGSGD 436 >At4g13750.1 68417.m02134 expressed protein Length = 2137 Score = 28.7 bits (61), Expect = 1.9 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 12/75 (16%) Query: 13 FQGFIKIYKQFFPQGDPSKFASLVFRVF----DENNDGS-----IEFEEFIRALSVTSRG 63 FQ ++KI QF PS A VF++F D+ N G I F+E + L T Sbjct: 1586 FQEYLKILGQFAHNVSPSSAAKAVFKIFLKWSDDLNSGKSSEDVIHFKERLSELEYTVLP 1645 Query: 64 NLDEK---LHWAFRL 75 ++K LH +F L Sbjct: 1646 TENDKWVSLHSSFGL 1660 >At1g64060.1 68414.m07256 respiratory burst oxidase protein F (RbohF) (RbohAp108) / NADPH oxidase identical to cytochrome b245 beta chain homolog RbohAp108 [GI:2654868], respiratory burst oxidase protein F [gi:3242456], from Arabidopsis thaliana Length = 944 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 105 QPEDENTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 Q DE+ R+ FD +DKN D R+T EE +E Sbjct: 259 QINDESF-DSRLQIFFDIVDKNEDGRITEEEVKE 291 >At5g03110.1 68418.m00259 expressed protein various predicted proteins, Arabidopsis thaliana Length = 283 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query: 29 PSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDND 81 P + +SL FR ++ENN +E ++ +R+ S + EK++ VD D Sbjct: 193 PYRSSSLAFRFWEENNQREVESQQNVRSEKTDSEVPI-EKINGFHEPEYVDRD 244 >At4g25090.1 68417.m03604 respiratory burst oxidase, putative / NADPH oxidase, putative similar to respiratory burst oxidase protein A from Arabidopsis thaliana, gb:AF055353 [gi:3242781], protein D [gi:3242789]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 849 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Query: 115 RVDKIFDQMDKNHDDRLTLEEFRE 138 R+ FD MDK+ D RLT +E RE Sbjct: 180 RLITFFDLMDKDSDGRLTEDEVRE 203 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 64 NLDEKLHWAFRLYDVDNDGYITRDEMYNIV 93 + D +L F L D D+DG +T DE+ I+ Sbjct: 176 SFDSRLITFFDLMDKDSDGRLTEDEVREII 205 >At5g51060.1 68418.m06329 respiratory burst oxidase protein C (RbohC) / NADPH oxidase nearly identical to respiratory burst oxidase protein C from Arabidopsis thaliana [gi:3242785] Length = 905 Score = 27.9 bits (59), Expect = 3.3 Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 115 RVDKIFDQMDKNHDDRLTLEEFRE 138 R+ FD +DK+ D RLT +E RE Sbjct: 230 RLKTFFDMVDKDADGRLTEDEVRE 253 >At3g63150.1 68416.m07092 GTP-binding protein-related low similarity to SP|Q38912 RAC-like GTP binding protein ARAC3 (GTP-binding protein ROP6) {Arabidopsis thaliana}; contains Pfam profile PF00036: EF hand (domain) Length = 643 Score = 27.9 bits (59), Expect = 3.3 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Query: 73 FRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPED 108 F+LYD+DNDG + E+ D ++Q +P ED Sbjct: 324 FQLYDLDNDGALQPAEL----DDLFQTAPDSPWLED 355 >At1g12310.1 68414.m01423 calmodulin, putative similar to calmodulin SP:P04465 from [Trypanosoma brucei gambiense] Length = 148 Score = 27.9 bits (59), Expect = 3.3 Identities = 21/92 (22%), Positives = 45/92 (48%), Gaps = 6/92 (6%) Query: 27 GDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGN-LDEKLHWAFRLYDVDNDGYIT 85 G+P++ A L + EN +F F+ ++ + D +L AF++ D + G++ Sbjct: 43 GNPTQ-AQLKSIIASENLSSPFDFNRFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVA 101 Query: 86 RDEMYNIVDAIYQMVGQTPQPEDENTPQKRVD 117 ++ +I+ +I G+ +P + + K VD Sbjct: 102 VADLRHILTSI----GEKLEPNEFDEWIKEVD 129 >At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) nearly identical to gi:4467359 Length = 1121 Score = 27.5 bits (58), Expect = 4.3 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 18 KIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKL 69 KI+K+ P P +L+FR + +D E E F + L S+G DE + Sbjct: 216 KIFKKLIPS--PKVRDALMFRKSADKDDEESEKEGFFKRLLRDSKGEGDEPI 265 >At5g60010.1 68418.m07525 ferric reductase-like transmembrane component family protein similar to respiratory burst oxidase protein D RbohD from Arabidopsis thaliana, EMBL:AF055357 [gi:3242789], respiratory burst oxidase homolog from Solanum tuberosum [GI:16549089]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 839 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Query: 115 RVDKIFDQMDKNHDDRLTLEEFRE 138 R+ FD DKN D +LT EE +E Sbjct: 199 RLQIFFDMCDKNGDGKLTEEEVKE 222 >At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative strong similarity to gi:4467359 Length = 1116 Score = 27.5 bits (58), Expect = 4.3 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 18 KIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEK 68 KI+K+ P P +L+FR + D E + F + L SRG DE+ Sbjct: 214 KIFKRLIPS--PKVRDALLFRKSADKEDEECEKDGFFKRLLRDSRGEDDEQ 262 >At3g01830.2 68416.m00127 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum]; Pfam HMM hit: EF hand Length = 137 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/37 (27%), Positives = 22/37 (59%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYD 77 + +D S+E E+F++ + + ++ L AF+LY+ Sbjct: 59 ESTDDKSLELEDFVKLVEEGEEADKEKDLKEAFKLYE 95 >At1g62820.1 68414.m07092 calmodulin, putative similar to calmodulin SP:P04465 from [Trypanosoma brucei gambiense]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 148 Score = 27.5 bits (58), Expect = 4.3 Identities = 21/92 (22%), Positives = 45/92 (48%), Gaps = 6/92 (6%) Query: 27 GDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSRGN-LDEKLHWAFRLYDVDNDGYIT 85 G+P++ + L + EN +F F+ ++ + D +L AF++ D + G++ Sbjct: 43 GNPTE-SQLKSIITTENLSSPFDFNRFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVA 101 Query: 86 RDEMYNIVDAIYQMVGQTPQPEDENTPQKRVD 117 ++ +I+ +I G+ QP + + K VD Sbjct: 102 VADLRHILTSI----GEKLQPSEFDEWIKEVD 129 >At1g18530.1 68414.m02312 calmodulin, putative similar to calmodulin GI:1565285 from [Toxoplasma gondii] Length = 157 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 41 DENNDGSIEFEEFIRALSVTSRGNL---DEKLHWAFRLYDVDNDGYITRDEM 89 D N +G +EF+E + + + E+L F+ +D D +G+I+ E+ Sbjct: 52 DSNGNGFVEFDELVGTILPDLNEEVLINSEQLLEIFKSFDRDGNGFISAAEL 103 >At1g09090.2 68414.m01015 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 843 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 110 NTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 N+ R+ FD +DKN D R+T +E +E Sbjct: 170 NSFDDRLQIFFDMVDKNLDGRITGDEVKE 198 >At1g09090.1 68414.m01014 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 622 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 110 NTPQKRVDKIFDQMDKNHDDRLTLEEFRE 138 N+ R+ FD +DKN D R+T +E +E Sbjct: 170 NSFDDRLQIFFDMVDKNLDGRITGDEVKE 198 >At5g58440.1 68418.m07319 phox (PX) domain-containing protein similar to SP|O60749 Sorting nexin 2 {Homo sapiens}; contains Pfam profile PF00787: PX domain Length = 587 Score = 27.1 bits (57), Expect = 5.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 28 DPSKFASLVFRVFDENNDGSIEFEE 52 +P +A ++F FDEN+D I E Sbjct: 105 EPPSYADVIFSPFDENSDSEINGTE 129 >At4g28220.1 68417.m04044 NADH dehydrogenase-related similar to 64 kDa mitochondrial NADH dehydrogenase [Neurospora crassa] GI:4753821, alternative NADH-dehydrogenase [Yarrowia lipolytica] GI:3718005; contains Pfam profile PF00070: Pyridine nucleotide-disulphide oxidoreductase Length = 571 Score = 27.1 bits (57), Expect = 5.7 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 6/77 (7%) Query: 73 FRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPE--DENTPQKRVDKIFDQMDKNHDDR 130 F+ D DN G +T +E+ +VD I + + PQ E ++ + ++ + + N Sbjct: 381 FKAADADNSGTLTMEELEGVVDDI---IVRYPQVELYLKSKHMRHINDLLADSEGNARKE 437 Query: 131 LTLEEFREG-SKADPRI 146 + +E F+ S+AD ++ Sbjct: 438 VDIEAFKLALSEADSQM 454 >At2g30130.1 68415.m03667 LOB domain protein 12 / lateral organ boundaries domain protein 12 (LBD12) identical to SP|Q8LBW3 LOB domain protein 12 {Arabidopsis thaliana} Length = 193 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 19 IYKQFFPQGDPSKFASLVFRVFDENN 44 I+ +FP DP KFA +V +VF +N Sbjct: 24 IFAPYFPPDDPHKFA-IVHKVFGASN 48 >At4g03560.1 68417.m00488 two-pore calcium channel (TPC1) identical to two-pore calcium channel (TPC1) [Arabidopsis thaliana] gi|14041819|dbj|BAB55460 Length = 733 Score = 26.6 bits (56), Expect = 7.5 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Query: 69 LHWAFRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHD 128 L AF L D D +G I +++ + + Q+ P+ ++ IFD++D D Sbjct: 327 LEKAFGLIDSDKNGEIDKNQCIKLFE---QLTNYRTLPK---ISKEEFGLIFDELDDTRD 380 Query: 129 DRLTLEEFRE 138 ++ +EF + Sbjct: 381 FKINKDEFAD 390 >At3g45810.1 68416.m04958 ferric reductase-like transmembrane component family protein similar to respiratory burst oxidase protein D RbohD from Arabidopsis thaliana, EMBL:AF055357 [gi:3242789], similar to respiratory burst oxidase protein D RbohD from Arabidopsis thaliana, EMBL:AF055357 [gi:3242789], respiratory burst oxidase homolog from Solanum tuberosum [GI:16549089]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 912 Score = 26.6 bits (56), Expect = 7.5 Identities = 17/71 (23%), Positives = 32/71 (45%), Gaps = 4/71 (5%) Query: 27 GDPSKFASLVFRVFDENN----DGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDG 82 GD +FA+ V+ + I+ E+ + +LD +L F + D D DG Sbjct: 164 GDTLEFAAKVYEALGRRRQIKTENGIDKEQLKLFWEDMIKKDLDCRLQIFFDMCDKDGDG 223 Query: 83 YITRDEMYNIV 93 +T +E+ ++ Sbjct: 224 KLTEEEVKEVI 234 >At3g27650.1 68416.m03453 LOB domain protein 25 / lateral organ boundaries domain protein 25 (LBD25) identical to LOB DOMAIN 25 [Arabidopsis thaliana] GI:17227166 Length = 159 Score = 26.6 bits (56), Expect = 7.5 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 19 IYKQFFPQGDPSKFASLVFRVFDENNDGSIEFE 51 ++ +FP +P+KFA+ V R+F +N I E Sbjct: 55 VFAPYFPPEEPTKFAN-VHRIFGASNVSKILHE 86 >At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related protein, putative similar to kinesin like protein GB:CAB10194 from [Arabidopsis thaliana] Length = 1313 Score = 26.6 bits (56), Expect = 7.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Query: 79 DNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKI 119 D+DG + V+ + +G +P ED N RV+KI Sbjct: 505 DDDGDTEMEIDEEAVERLCAQMGLSPPAEDNNQEMSRVEKI 545 >At1g31320.1 68414.m03832 LOB domain protein 4 / lateral organ boundaries domain protein 4 (LBD4) identical to SP|Q9SHE9 LOB domain protein 4 {Arabidopsis thaliana} Length = 172 Score = 26.6 bits (56), Expect = 7.5 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 19 IYKQFFPQGDPSKFASLVFRVFDENN 44 ++ +FP +P KFA+ V RVF +N Sbjct: 29 VFSPYFPADEPQKFAN-VHRVFGASN 53 >At1g09720.1 68414.m01091 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 928 Score = 26.6 bits (56), Expect = 7.5 Identities = 9/27 (33%), Positives = 17/27 (62%) Query: 64 NLDEKLHWAFRLYDVDNDGYITRDEMY 90 +++EK+ + ++ D D D + R EMY Sbjct: 32 DMEEKVKYTLKIIDGDGDSFAKRAEMY 58 >At5g58410.1 68418.m07314 expressed protein contains similarity to hypothetical proteins Length = 1873 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 10 FCVFQGFIKIYKQFFPQGDPSKFASLVFRVFDENN 44 + + FIK + F +GD A + VF ENN Sbjct: 305 YSLLSSFIKNVPEVFGEGDVRSLAPALLGVFRENN 339 >At5g10500.1 68418.m01216 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 848 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/27 (33%), Positives = 18/27 (66%) Query: 64 NLDEKLHWAFRLYDVDNDGYITRDEMY 90 +++EK+ +A +L + + D + R EMY Sbjct: 32 DIEEKVEYALKLLEDEGDSFAKRAEMY 58 >At2g45670.1 68415.m05678 calcineurin B subunit-related contains Pfam PF00036: EF hand domain and Prosite PS00018: EF-hand calcium-binding domain; contains Pfam profile PF01553: Acyltransferase; weak similarity to Calcineurin B subunit isoform 2 (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B alpha isoform 2) (Swiss-Prot:Q63811) [Mus musculus] Length = 539 Score = 26.2 bits (55), Expect = 10.0 Identities = 15/55 (27%), Positives = 26/55 (47%) Query: 35 LVFRVFDENNDGSIEFEEFIRALSVTSRGNLDEKLHWAFRLYDVDNDGYITRDEM 89 L F D + DG I +E AL T +++ + L D D D I+++++ Sbjct: 464 LAFSHCDADGDGYITIQELGEALKNTIPNLNKDEIRGMYHLLDDDQDQRISQNDL 518 >At2g34030.1 68415.m04166 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 566 Score = 26.2 bits (55), Expect = 10.0 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 6/100 (6%) Query: 21 KQFFPQGDPSKFA-SLVFRVFDENNDGSI---EFEEFIRALSVTSRGNLD-EKLHWAF-R 74 K G+ SK + +F+ D+N DG I E ++ LS R D +L AF Sbjct: 288 KHLIKDGELSKESLKSLFKKTDKNKDGKIQISELKDLTIELSNFGRMRYDINELAKAFLE 347 Query: 75 LYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQK 114 +D DNDG + +E + + + + + EN ++ Sbjct: 348 DFDGDNDGELEENEFEEGIARLLKQYKFNVEDQRENQTEE 387 >At1g59620.1 68414.m06705 disease resistance protein (CC-NBS class), putative domain signature CC-NBS exists, suggestive of a disease resistance protein. Length = 842 Score = 26.2 bits (55), Expect = 10.0 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Query: 31 KFASLVFRVFDENND--GSIEFEEFIRALSVTSRGNLDEK 68 K+ SL R+ D++ G ++F +RALS+ RG L+ K Sbjct: 610 KYLSLPLRMDDKSMGEWGDLQFMTRLRALSIYIRGRLNMK 649 >At1g53210.1 68414.m06031 sodium/calcium exchanger family protein / calcium-binding EF hand family protein contains Pfam profiles: PF01699 sodium/calcium exchanger protein, PF00036 EF hand Length = 585 Score = 26.2 bits (55), Expect = 10.0 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 7/69 (10%) Query: 73 FRLYDVDNDGYITRDEMYNIVDAIYQMVGQTPQPEDENTPQKRVDKIFDQMDKNHDDRLT 132 F D +NDG+++ E+ ++ +G + + D + V K+ DK D+++ Sbjct: 308 FLTIDANNDGHLSAAELKALI------IGISFEDIDFDKDDA-VGKVLQDFDKTLDEQVD 360 Query: 133 LEEFREGSK 141 EEF G K Sbjct: 361 QEEFVRGIK 369 >At1g20060.1 68414.m02511 kinesin motor protein-related Length = 951 Score = 26.2 bits (55), Expect = 10.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 109 ENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADP 144 E KR K F + +KN +L+ + +G KADP Sbjct: 466 EEPCNKRQLKTFPRAEKNKKIKLSAPKTSQGKKADP 501 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 26.2 bits (55), Expect = 10.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 115 RVDKIFDQMDKNHDDRLTLEEFRE 138 R+ FD D N D ++T EE +E Sbjct: 272 RLQIFFDMADSNEDGKITREEIKE 295 >At1g03470.1 68414.m00328 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 269 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/26 (46%), Positives = 14/26 (53%) Query: 65 LDEKLHWAFRLYDVDNDGYITRDEMY 90 LDEK R+ D D D + R EMY Sbjct: 30 LDEKTKEMLRVIDEDADSFAARAEMY 55 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.321 0.140 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,041,559 Number of Sequences: 28952 Number of extensions: 176914 Number of successful extensions: 1022 Number of sequences better than 10.0: 162 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 24 Number of HSP's that attempted gapping in prelim test: 503 Number of HSP's gapped (non-prelim): 409 length of query: 155 length of database: 12,070,560 effective HSP length: 75 effective length of query: 80 effective length of database: 9,899,160 effective search space: 791932800 effective search space used: 791932800 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -