BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000708-TA|BGIBMGA000708-PA|undefined (487 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 3.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 8.0 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 25.4 bits (53), Expect = 3.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Query: 408 PYTVVEVAMCHYQLGDKDKAVQLLNEA 434 P + VA HY+LG+ D+A+ L +A Sbjct: 450 PEILNNVAALHYRLGNLDEAMSKLEQA 476 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.2 bits (50), Expect = 8.0 Identities = 13/61 (21%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Query: 217 WEIMWVNSLKMEWREAAQYATKLMDESSWSRTIYSYTKAAMLLQLGSDMTPNEKHQCNEL 276 W+ +W+ + ++ ++ +DES W + + GSD+T +H C+E Sbjct: 55 WKALWIRDGFFDGKQREFRSSFFVDESGW-LLVRNREGLQFYRMEGSDLT--LRHYCSEA 111 Query: 277 L 277 + Sbjct: 112 I 112 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.324 0.137 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,105 Number of Sequences: 2123 Number of extensions: 16859 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 31 Number of HSP's gapped (non-prelim): 3 length of query: 487 length of database: 516,269 effective HSP length: 67 effective length of query: 420 effective length of database: 374,028 effective search space: 157091760 effective search space used: 157091760 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -